[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:virS"

virS        "two-component sensor histidine kinase"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------1----------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1---1----1-1--------------------1---1----------111-------------------------------------------11---111--52111111221-1-4533-222311-1-7C--212-------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLMNQMFWDFMENASMIIEWVSFYLIISQFSPKKRKNKQEVYSFIVIIIFSVLLKVLNVY:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|43->54|sfiviiifsvll 61: . . . * . .: 120 :PNERIVICFFIGLIYYKFNFRVNNIKCIMISLIFWLFMLTVEALSISFIVKINSLVNVSD:Sequence : :Sec Str 121: . . + . . .: 180 :LLGKNIYRMETMILSKVILISLIMVVRCLKFRVDIGKGDFIYILTPIATNIIIILVIFGY:Sequence : :Sec Str : XXXXXXXXXXXXXXXXX :SEG|161->177|iyiltpiatniiiilvi 181: . * . . . .: 240 :AFKGGREGFGDNVSIFFVSILLLLSNMSLMFIVSKIIKNNKLKLENEFIKDKLEMEYKYY:Sequence : cEcHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|193->210|vsiffvsillllsnmslm : XXXXXXXXXXXXXXXX :SEG|215->230|kiiknnklklenefik 241: + . . . . *: 300 :SNLKDNQEKVKRLYHDIKNHIACIEGNNKETGIRKKYIDSLNSEIDKLNLGFNTGNEVLD:Sequence :cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccTTcEEEEEHHHHHHHHHccEHHHH:Sec Str : ########## :PROS|290->299|PS00659|GLYCOSYL_HYDROL_F5|PDOC00565| : =====:RP:SCP|296->436|2c2aA2|1e-04|15.1|139/151|d.122.1.3 : ========:BL:SWS|293->394|YR472_MIMIV|4e-04|27.5|102/1700 301: . . . . + .: 360 :VILNNKREKCMENNISLKVFIDFSKVNFIEYFDICTIFSNCIDNAIEACKKIKDNNRYIS:Sequence :HHHHHHHcccccEEEEEEEcccTTcccEEEEHHHHHHHHHHHHHHHHHHHTTccccccEE:Sec Str :============================================================:RP:SCP|296->436|2c2aA2|1e-04|15.1|139/151|d.122.1.3 :============================================================:BL:SWS|293->394|YR472_MIMIV|4e-04|27.5|102/1700 361: . . . * . .: 420 :LKGNCVNNFYVIKIENSKTNKIKKLNGDFLTDKKDKFLHGIGLKNIRLALEKYNGEIIIE:Sequence :EEEEEcccEEEEEEEEEEEcccHHHHHHHHTcTTTTcccccHHHHHHHHHHHTTcEEEEE:Sec Str :============================================================:RP:SCP|296->436|2c2aA2|1e-04|15.1|139/151|d.122.1.3 :================================== :BL:SWS|293->394|YR472_MIMIV|4e-04|27.5|102/1700 421: . . + . . .: 480 :PLDDKFILKMLIPINQEKEA :Sequence :EETTEEEEEEEEEccGGGcc :Sec Str :================ :RP:SCP|296->436|2c2aA2|1e-04|15.1|139/151|d.122.1.3