[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB81206.1 cper0 virS "two-component sensor histidine kinase"
MLMNQMFWDFMENASMIIEWVSFYLIISQFSPKKRKNKQEVYSFIVIIIFSVLLKVLNVY
PNERIVICFFIGLIYYKFNFRVNNIKCIMISLIFWLFMLTVEALSISFIVKINSLVNVSD
LLGKNIYRMETMILSKVILISLIMVVRCLKFRVDIGKGDFIYILTPIATNIIIILVIFGY
AFKGGREGFGDNVSIFFVSILLLLSNMSLMFIVSKIIKNNKLKLENEFIKDKLEMEYKYY
SNLKDNQEKVKRLYHDIKNHIACIEGNNKETGIRKKYIDSLNSEIDKLNLGFNTGNEVLD
VILNNKREKCMENNISLKVFIDFSKVNFIEYFDICTIFSNCIDNAIEACKKIKDNNRYIS
LKGNCVNNFYVIKIENSKTNKIKKLNGDFLTDKKDKFLHGIGLKNIRLALEKYNGEIIIE
PLDDKFILKMLIPINQEKEA
//