[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO48556.1"

            "DNA replication and repair protein RecF"
RECF_DESRM  "RecName: Full=DNA replication and repair protein recF;"

OrgPattern -------------------------------------------------------------------- ----111111111111112-111111111111111111111111111111111111111111111111111111111111111-----111111111--111111111111111111111--2-11111111111111111---1111111111111111111111111111111111111111111122-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------11111-------------11111111111---------1--1-111---------------1----1--11111111---1-1--11--------1111111111111111-11-11--1-----------------------------------------------------------------------1--------------111111111--1-1------------------------------111111111111111111111111111111--11-11------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111--11111111---1-111111-------------------------1----------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDV:Sequence :cEEEEEEEEccTTccccEEEccccEEEEEccTTTccTHHHHHHHHTcccccTTcccccTT:Sec Str :============================================================:RP:SCP|1->93|1f2t.1|6e-15|22.6|93/288|c.37.1.12 :============================================================:BL:SWS|1->371|RECF_DESRM|0.0|100.0|371/371 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->190|PF02463|1e-06|30.6|183/536|SMC_N 61: . . . * . .: 120 :TNWESNHTVINTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLS:Sequence :cccccEEEEEEEEEEETTEEEEEEEEEETTEEEEEETTEEEcGGGcccccEEEEcTTTTH:Sec Str : #######:PROS|114->134|PS00617|RECF_1|PDOC00539| :================================= :RP:SCP|1->93|1f2t.1|6e-15|22.6|93/288|c.37.1.12 :============================================================:BL:SWS|1->371|RECF_DESRM|0.0|100.0|371/371 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->190|PF02463|1e-06|30.6|183/536|SMC_N 121: . . + . . .: 180 :LIKGSPQERRHFLDYEVGTLSPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDE:Sequence :HHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTHHHHHTcGGGTTTTHH:Sec Str :############## :PROS|114->134|PS00617|RECF_1|PDOC00539| :============================================================:BL:SWS|1->371|RECF_DESRM|0.0|100.0|371/371 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->190|PF02463|1e-06|30.6|183/536|SMC_N 181: . * . . . .: 240 :QLYRYGAKVIYLRLQVLKKLIPIARKTHFGLTGGTEELQAKYLSSLVLEPGLSEGQIYQV:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHH HHHHHTTccccEEEEEEccccTTT:Sec Str :============================================================:BL:SWS|1->371|RECF_DESRM|0.0|100.0|371/371 :$$$$$$$$$$ :RP:PFM|3->190|PF02463|1e-06|30.6|183/536|SMC_N 241: + . . . . *: 300 :FSSSSKKIRQMELKRCQTLLGPHRDDLSLAINGVEAKTFGSQGQQRTVTLSLKLSQLDLW:Sequence :HHHHHHHTHHHHHHHTcccccGGGcEEEEEETTEEHHHHccHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->371|RECF_DESRM|0.0|100.0|371/371 301: . . . . + .: 360 :YHEFGEYPVLLLDDVLFELDRSRQNMLIDKILNKVQTFITTSFTGGIEETIKGAGLLWQV:Sequence :HHHHccccEEEEccGGGcccHHHHHHHHHHHHHccEEEEEEc cccTTccEEEEE:Sec Str : XXXXXXXX :SEG|309->316|vlllddvl : ################### :PROS|309->327|PS00618|RECF_2|PDOC00539| :============================================================:BL:SWS|1->371|RECF_DESRM|0.0|100.0|371/371 361: . . . * . .: 420 :NAGSLTQKEEF :Sequence :ETTEEE :Sec Str :=========== :BL:SWS|1->371|RECF_DESRM|0.0|100.0|371/371