[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO48556.1 dred0 ABO48556.1 "DNA replication and repair protein RecF"
MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDV
TNWESNHTVINTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLS
LIKGSPQERRHFLDYEVGTLSPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDE
QLYRYGAKVIYLRLQVLKKLIPIARKTHFGLTGGTEELQAKYLSSLVLEPGLSEGQIYQV
FSSSSKKIRQMELKRCQTLLGPHRDDLSLAINGVEAKTFGSQGQQRTVTLSLKLSQLDLW
YHEFGEYPVLLLDDVLFELDRSRQNMLIDKILNKVQTFITTSFTGGIEETIKGAGLLWQV
NAGSLTQKEEF
//