[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO48569.1"

            "tRNA-adenosine deaminase"
            ""

OrgPattern ----------------------------1---1-----111111-1-1-2111--------------- 212-2-1211111112211-12111111111121111211112112211111333111111121212221111111111111111211332311221--1111112112211111111111111122111111112----------223322111221111131222333111111111111111111111111111112121111111212222111111121111111123111111--11111111111111111111111111122111112111111111111122222222222-1111111111111111111111211122223323221111111111121111111111111111111121-1123111-11111123211111111111111111111-221222221111211212222211111111111111211111111111111112111111111111111111111111111111-111111111111131111111111211111121111211111111211211121111111111111111111111221233111212111121111122211111121--------------------21--1111111111121112222111222212112111-1211111111111111111111111111-1111111111111111111212112111111111111111111111111111111111111111111112222211112112111111111111111122212221111222223211111112222111111111111111111111111221212222211111111111111----------111111------------------------------422 ----22----111112221-1121121221111111-111-1111---11---------1-1212212-22212222-22211121-1-23221221-111-11-1--41-222232-11112-21221362-213111-21112-2---11-2-11113-113-111-1-321-111222221243451322232222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSHALFMREALIEAQKAAVKGEVPIGAVVVWKDEVIGRGYDLRESLCDASAHAEILAMRK:Sequence :ccHHHHHHHHHHHHHHHHTTTccccEEEEEETTEEEEEEEccHHHHTcTTccHHHHHHHH:Sec Str : #########:PROS|52->89|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| :============================================================:RP:SCP|1->151|1wwrA1|5e-44|40.7|150/151|c.97.1.2 : =======================================================:BL:SWS|6->151|TADA_STRP1|7e-39|50.0|146/171 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->100|PF00383|4e-19|47.9|94/100|dCMP_cyt_deam_1 61: . . . * . .: 120 :AAKHLGDWRLNDATLYVTVEPCAMCAGAIVQFRINRLVYGAPNAKSGSVDTILNIVQEAR:Sequence :HHHHHTccccTTcEEEEEEcccHHHHHHHHHHTccEEEEEEccTTTcTcTTcccGGGcTT:Sec Str :############################# :PROS|52->89|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| :============================================================:RP:SCP|1->151|1wwrA1|5e-44|40.7|150/151|c.97.1.2 :============================================================:BL:SWS|6->151|TADA_STRP1|7e-39|50.0|146/171 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->100|PF00383|4e-19|47.9|94/100|dCMP_cyt_deam_1 121: . . + . . .: 180 :FNHRVEVIAGILEDQCKEIIQNFFRELRKNK :Sequence :cccccEEEccTTHHHHHHHHHHHHHHHHHHc :Sec Str :=============================== :RP:SCP|1->151|1wwrA1|5e-44|40.7|150/151|c.97.1.2 :=============================== :BL:SWS|6->151|TADA_STRP1|7e-39|50.0|146/171