[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO48689.1"

            "4Fe-4S ferredoxin, iron-sulfur binding domain protein"
            ""

OrgPattern -----------------------------1------------------1-----221-122-111--- ------------------------11-------111-11-1-1-------------------------------------11---11-----1--------------------------------22222111211-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111112-1--1221-1------11--3211-11211----1-1----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------11--212111111-2221113-2-----111-------------------------111-----------------------------------1---------------------------1-----------------------11-1111111111111-------------------------------1111------------------------------1------------------1---------------------------------------1--------------------------------------------1--------2-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MILNKSETASLLDKLANEYRVIAPVEKEGLVQFAAIQKGEEAKLDYMNAKKPGKEILFPQ:Sequence : :Sec Str : ==========================================================:BL:SWS|3->331|ASRA_SALTY|1e-16|27.1|310/347 61: . . . * . .: 120 :SEELYSYTVDAEGVRMQDNVDPKATIVFGMRPCDVKSMVLLDNVFKNDQYEDVYYLTRRA:Sequence : :Sec Str :============================================================:BL:SWS|3->331|ASRA_SALTY|1e-16|27.1|310/347 121: . . + . . .: 180 :NTLIVGLGCNEPSATCFCSSMSCGPFAKEGSDIFLTDIGEAYVVEGISEKGKELLAKLGL:Sequence : :Sec Str : XXXXXXXXXXXXX:SEG|168->193|sekgkellaklglaeasaeakgqaak :============================================================:BL:SWS|3->331|ASRA_SALTY|1e-16|27.1|310/347 181: . * . . . .: 240 :AEASAEAKGQAAKLQEETKADGSVNIEGLAEKLGGMFEHPYWDSLYEKCLGCGACTYLCP:Sequence : TccccccEEEEE cTGGGTTTcHHHHHcc:Sec Str :XXXXXXXXXXXXX :SEG|168->193|sekgkellaklglaeasaeakgqaak : ############:PROS|229->240|PS00198|4FE4S_FER_1|PDOC00176| : ========================:RP:SCP|217->331|1nekB1|8e-09|17.0|94/132|a.1.2.1 :============================================================:BL:SWS|3->331|ASRA_SALTY|1e-16|27.1|310/347 241: + . . . . *: 300 :TCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSGHNPRPGGKARWRQRLMHKFNYFVE:Sequence :ccHHHHHHHTcccccHHHHTcHHHHHcTTccHHHHHHHHHHHTcTTccccHHHHHHHHcc:Sec Str :============================================================:RP:SCP|217->331|1nekB1|8e-09|17.0|94/132|a.1.2.1 :============================================================:BL:SWS|3->331|ASRA_SALTY|1e-16|27.1|310/347 301: . . . . + .: 360 :RYNATACVGCGRCIKNCPVNLDIRQVLADVRALD :Sequence :TTTGGGcccccHHHHHcTTcccHHHHHHHHHGcc :Sec Str : ############ :PROS|307->318|PS00198|4FE4S_FER_1|PDOC00176| :=============================== :RP:SCP|217->331|1nekB1|8e-09|17.0|94/132|a.1.2.1 :=============================== :BL:SWS|3->331|ASRA_SALTY|1e-16|27.1|310/347