[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO48689.1 dred0 ABO48689.1 "4Fe-4S ferredoxin, iron-sulfur binding domain protein"
MILNKSETASLLDKLANEYRVIAPVEKEGLVQFAAIQKGEEAKLDYMNAKKPGKEILFPQ
SEELYSYTVDAEGVRMQDNVDPKATIVFGMRPCDVKSMVLLDNVFKNDQYEDVYYLTRRA
NTLIVGLGCNEPSATCFCSSMSCGPFAKEGSDIFLTDIGEAYVVEGISEKGKELLAKLGL
AEASAEAKGQAAKLQEETKADGSVNIEGLAEKLGGMFEHPYWDSLYEKCLGCGACTYLCP
TCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSGHNPRPGGKARWRQRLMHKFNYFVE
RYNATACVGCGRCIKNCPVNLDIRQVLADVRALD
//