[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO48707.1"

            "metal dependent phosphohydrolase"
            ""

OrgPattern -------------------------------------------------------------------- 11--111111111111111-111111111111111111111111-1111111111-1-11--111111111-------1----21112111111111--11111-111-1---------------111-----11-111112221-11111111111111111111111111111111111111----222------------------12--------------------1-------------------1-1-------------------1-------------1111111111111--------------11---1111-2-11111111111112111---1-21-1-1122222112221222-----2---------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1----------1111111-------1112111-1111---1--1121------112------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------111------------------1-----------------------------------------1-111----------------------------11-11111-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSTISMLSQQLSIQTYLVGGAVRDLFLNKIPVDLDFCVTAKVFALAQTLTQQYQGSLVTL:Sequence : HHHHHHHTTccEEEETHHcTTcHHTcccHHHHHHHHHHHHHHHHHHHHHHcccGGGH:Sec Str : ===============================================:RP:SCP|14->103|1ou5A2|3e-15|25.6|90/140|d.218.1.4 : ================================================:BL:SWS|13->327|CCA_THICR|1e-16|31.5|273/416 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->107|PF01743|6e-08|39.1|92/123|PolyA_pol 61: . . . * . .: 120 :DDQREMLRVVTNSWHLDFSPLRDEILEKDLFARDFTLNAMALPVSMGINKYNWQNQIQDP:Sequence :HHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcGEccGGEccccHHHHHHGG:Sec Str :=========================================== :RP:SCP|14->103|1ou5A2|3e-15|25.6|90/140|d.218.1.4 :============================================================:BL:SWS|13->327|CCA_THICR|1e-16|31.5|273/416 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|16->107|PF01743|6e-08|39.1|92/123|PolyA_pol 121: . . + . . .: 180 :TGGKGDLKKGLLRAASSSSIQQDPLRSLRGIRFAATYNLAIIPETMVLLRQGTRRIEQIA:Sequence :cHHHHHTTTcccHHHHHHHHHHHHHHHTTHHHHHHHHHcccHHHHHHHHHHHHHHTTTTc:Sec Str : XXXXXXXXXXX :SEG|122->132|ggkgdlkkgll : ==============================================:RP:SCP|135->327|1ou5A1|9e-15|17.7|181/204|a.173.1.1 :============================================================:BL:SWS|13->327|CCA_THICR|1e-16|31.5|273/416 181: . * . . . .: 240 :GERLWHELAILFKLPITSFWINYMDQELHFWQYLLPGQLRMAQTKQNHYHVENVWRHCLR:Sequence :GGGcHHHHHHHHHHHTTccccTTc cccHHHHHHHHHHHHHHHc ccTHHHHHH:Sec Str :============================================================:RP:SCP|135->327|1ou5A1|9e-15|17.7|181/204|a.173.1.1 :============================================================:BL:SWS|13->327|CCA_THICR|1e-16|31.5|273/416 241: + . . . . *: 300 :TYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSRCQVLKLAALIHDVGKPDTAVIRED:Sequence :HHHHHTcc cHHHHHHHHHHTTc cTT:Sec Str :============================================================:RP:SCP|135->327|1ou5A1|9e-15|17.7|181/204|a.173.1.1 :============================================================:BL:SWS|13->327|CCA_THICR|1e-16|31.5|273/416 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|279->323|PF01966|8e-05|46.7|45/117|HD 301: . . . . + .: 360 :GRISFHGHAEAGVPYAEALATRLKLSRLERHYLVNLVLLHMLPLNLYNSGDRSDLSVYRL:Sequence :TTHHHHTTcccccGGGcTTHHHHH :Sec Str : XXXXXXXXXXXXXXXXX :SEG|331->347|hylvnlvllhmlplnly :=========================== :RP:SCP|135->327|1ou5A1|9e-15|17.7|181/204|a.173.1.1 :=========================== :BL:SWS|13->327|CCA_THICR|1e-16|31.5|273/416 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|279->323|PF01966|8e-05|46.7|45/117|HD 361: . . . * . .: 420 :FRSLENYILDVLILSLADVTATLTAGERISELEAYRTFILNLLGKFIVEKDRFHPVPYLS:Sequence : :Sec Str 421: . . + . . .: 480 :GAALLELGIPEGPEVGLILEKLCEEQVTGSITDTKTALLWVKTKLAGNNKDK :Sequence : :Sec Str