[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO48823.1"

            "acetylornithine aminotransferase"
            ""

OrgPattern 44221334555555541433333333342253222233333332232222343254523233228-46 49579434555342F7777-7C449I757778GBBB89GI68994444254574554522D6A3F6FEGF81111121-12263434423221322-115465768573711111111122222133333333333999A81118943432243333343333324475723433333333336554411-86AAAAAA9999B9A9998B88889BC8667744333333A936666665666666656646-------2---2222-----231111-------121------------------------2--111----36256-------2-262663111313--532442243443333332322263455571111185D7B574666647899789798A-357438376M62EBBDBAKAAECF6644259AA9997AE44444444655234582122222222---------------2122214643BCCB9FIIGGGACCCAFFFHEEEE7CFFD67762387A6983385A6CB763333485333333344447527676354446334333343355433336956412333333322322222224433333764365B344795555666555555565851-1555321-22277A83787776766677-7777766777767777776ACA8B9C366665666666666667653666622445555455555--2322222444445898444323322223223888A76745487DEDEBJBH9IFFC7BGF422222222554445666669655667676755533333332663333------------------------------------1222212111643 11--443-1---11358857684C7C777434444455553544455579FCHE5865566455836A94336475325476454735-47484447464494554-575A5857574535554963549d6-5464433745564444363345C7556CC3B575676I57454663*33377ABCJ7887584958 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEV:Sequence :ccHcTHHHHHHHHcHHHHHHccccEEEEEcTEEEETTccEEEETTHHHHTcccccccHHH:Sec Str : =================================================:RP:SCP|12->393|1d7rA|e-100|33.0|376/431|c.67.1.4 : ==================================================:BL:SWS|11->389|ARGD_THETN|e-123|56.1|378/393 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->333|PF00202|3e-82|51.2|303/336|Aminotran_3 61: . . . * . .: 120 :AEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYA:Sequence :HHHHHHHHTTccccccccccHHHHHHHHHHHHHccTTEEEEEccHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|12->393|1d7rA|e-100|33.0|376/431|c.67.1.4 :============================================================:BL:SWS|11->389|ARGD_THETN|e-123|56.1|378/393 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->333|PF00202|3e-82|51.2|303/336|Aminotran_3 121: . . + . . .: 180 :KQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTI:Sequence :HHTTcTTccEEEEEccEEEccccGGGcccccHHHHHHcccccTTEEEEcTHHHHHHHHHH:Sec Str :============================================================:RP:SCP|12->393|1d7rA|e-100|33.0|376/431|c.67.1.4 :============================================================:BL:SWS|11->389|ARGD_THETN|e-123|56.1|378/393 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->333|PF00202|3e-82|51.2|303/336|Aminotran_3 181: . * . . . .: 240 :GPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQH:Sequence :HHHEEEEEEccEETTTTcEEccTTHHHHHHHHHHHTTcEEEEEcTTTTTTTTccccGGGG:Sec Str : #####################:PROS|220->257|PS00600|AA_TRANSFER_CLASS_3|PDOC00519| :============================================================:RP:SCP|12->393|1d7rA|e-100|33.0|376/431|c.67.1.4 :============================================================:BL:SWS|11->389|ARGD_THETN|e-123|56.1|378/393 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->333|PF00202|3e-82|51.2|303/336|Aminotran_3 241: + . . . . *: 300 :YGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLL:Sequence :GTccccEEEEcGGGGTTcccEEEEEEHHHHHTTcccccccccTTcHHHHHHHHHHHHHHH:Sec Str :################# :PROS|220->257|PS00600|AA_TRANSFER_CLASS_3|PDOC00519| :============================================================:RP:SCP|12->393|1d7rA|e-100|33.0|376/431|c.67.1.4 :============================================================:BL:SWS|11->389|ARGD_THETN|e-123|56.1|378/393 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->333|PF00202|3e-82|51.2|303/336|Aminotran_3 301: . . . . + .: 360 :QKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRGLGLMIGLELGIEGKDIVAHCLEQGLL:Sequence :HTTHHHHHHHHHHHHHHHHHHHTTTcTTEEEEEEETTEEEEEEcccTTHHHHHHHHTTEE:Sec Str : XXXXXXXXXXXXXX :SEG|334->347|glglmiglelgieg :============================================================:RP:SCP|12->393|1d7rA|e-100|33.0|376/431|c.67.1.4 :============================================================:BL:SWS|11->389|ARGD_THETN|e-123|56.1|378/393 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|27->333|PF00202|3e-82|51.2|303/336|Aminotran_3 361: . . . * . .: 420 :INCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV :Sequence :ccEEETTEEEEcccTTccHHHHHHHHHHHHHHHcHc :Sec Str :================================= :RP:SCP|12->393|1d7rA|e-100|33.0|376/431|c.67.1.4 :============================= :BL:SWS|11->389|ARGD_THETN|e-123|56.1|378/393