[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO48875.1 dred0 ABO48875.1 "hypothetical protein"
MKSNLQEYNERLRRIEEQKSAGKIKLWHLMNHEERISVMRLLYIKENLLEEDIAHLLETE
PTELQKFRRRQGTLFFQKPHPE
//