[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO48876.1"

            "protein of unknown function DUF6, transmembrane"
            ""

OrgPattern -----------------------1--------------1-11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-112112221112212------3211121---------51-----------------------------------------------------------------------------------111---1-1---1111111-1----------------------2--1-1----------------------111---1-11---------------------11---111-1111-111-----------------------------------------------------------1-------------------------------1------------------------2-1---1----------112----1-1---1111---------1-----------------------------------------------2111------------------1--------------------------------------------------1---------------------------------------------------------1-----------------------------------1-------------------11------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSAKRVYILMVLAALFWSGAFITGKLAVREFPPFALTFFRFSFALPFVLWEKPLTYLPNA:Sequence : ========================================================:BL:SWS|5->112|Y510_ARCFU|9e-13|34.3|105/289 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->135|PF00892|7e-08|32.2|121/125|EamA 61: . . . * . .: 120 :TTEGWLAILYMAVFASVLGYLFQLIAIQNIGAPKAAIFINLVPVFTIMQSLLFLGEPFSW:Sequence : ========================================================:RP:SCP|65->145|1s7bA|7e-05|12.3|81/106|f.39.1.1 :==================================================== :BL:SWS|5->112|Y510_ARCFU|9e-13|34.3|105/289 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->135|PF00892|7e-08|32.2|121/125|EamA 121: . . + . . .: 180 :FKMLSACIIVTGVYLTTRPESGVKEAAGIKA :Sequence :========================= :RP:SCP|65->145|1s7bA|7e-05|12.3|81/106|f.39.1.1 :$$$$$$$$$$$$$$$ :RP:PFM|15->135|PF00892|7e-08|32.2|121/125|EamA