[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO48876.1 dred0 ABO48876.1 "protein of unknown function DUF6, transmembrane"
MSAKRVYILMVLAALFWSGAFITGKLAVREFPPFALTFFRFSFALPFVLWEKPLTYLPNA
TTEGWLAILYMAVFASVLGYLFQLIAIQNIGAPKAAIFINLVPVFTIMQSLLFLGEPFSW
FKMLSACIIVTGVYLTTRPESGVKEAAGIKA
//