[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49029.1"

            "protein of unknown function DUF1540"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-1----------------1----1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHKSPRVLCEVNTCTHWLLGNLCTAANIDILYEEEGKMAQKDAHTECKTFYKKNGITSYL:Sequence :############################################################:PROS|1->112|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| 61: . . . * . .: 120 :GSMDNVNWGGLVSGSFREGQQITPAVVCIVESCKYWAKGNLCEAETIQVSGQNANECQDT:Sequence :#################################################### :PROS|1->112|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| 121: . . + . . .: 180 :NCKTFEEK :Sequence