[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49029.1 dred0 ABO49029.1 "protein of unknown function DUF1540"
MHKSPRVLCEVNTCTHWLLGNLCTAANIDILYEEEGKMAQKDAHTECKTFYKKNGITSYL
GSMDNVNWGGLVSGSFREGQQITPAVVCIVESCKYWAKGNLCEAETIQVSGQNANECQDT
NCKTFEEK
//