[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49033.1"

            "arginine decarboxylase"
            ""

OrgPattern ----------------1------2--------11111111111-------11-11111111------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLPTPKKYFVTAASSEGKSKLTAFDNALLKARIGNVNLLRVSSILPPGCQEDPGMVLPPG:Sequence : ccEEEEEEEEEEcccHHHHHHHHHHHHTcTTcEEEEcccEEcTTcEEcccccccTT:Sec Str : ========================================================:RP:SCP|5->153|1mt1.1|2e-43|54.7|148/160|d.155.1.2 : ========================================================:BL:SWS|5->153|PDAD_METJA|1e-42|56.4|149/165 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->141|PF01862|2e-20|42.3|137/159|PvlArgDC 61: . . . * . .: 120 :SLVPTAYGYIVSNVPGEIISACVGVGINSNDSFGVIMEFSGKCSKEEAEQNITNMVKEAF:Sequence :cEEEEEEEEEEEccTTcEEEEEEEEEEEccTTcEEEEEEEEcccHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|5->153|1mt1.1|2e-43|54.7|148/160|d.155.1.2 :============================================================:BL:SWS|5->153|PDAD_METJA|1e-42|56.4|149/165 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->141|PF01862|2e-20|42.3|137/159|PvlArgDC 121: . . + . . .: 180 :ETRGMELKDIKIASAEHKVEKIGCALAAVPLWY :Sequence :HHHTccEEEEEEEEEEEEccccEEEEEEEEEEc :Sec Str :================================= :RP:SCP|5->153|1mt1.1|2e-43|54.7|148/160|d.155.1.2 :================================= :BL:SWS|5->153|PDAD_METJA|1e-42|56.4|149/165 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->141|PF01862|2e-20|42.3|137/159|PvlArgDC