[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49038.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFQEYRQIVYRIKGLDKPLSSLTRAERNDVLNLSIRQEEIEKHIGQQIQKSFKELQEGLE:Sequence :============================================================:BL:SWS|1->60|TMCC1_MOUSE|2e-04|30.0|60/649 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->77|PF09794|9e-05|24.7|77/369|Avl9 61: . . . * . .: 120 :VVAEWVRLMKEDAIKALGIGGTPEEVLALEETLAQATSLNMQISGLTLANYSPPEKSEPE:Sequence :$$$$$$$$$$$$$$$$$ :RP:PFM|1->77|PF09794|9e-05|24.7|77/369|Avl9 121: . . + . . .: 180 :KHQQTEEPVKTPIKIIKAERPKHKPTLPVFDSTIDMVENNVDQKIVSKVIKEINESVTAA:Sequence 181: . * . . . .: 240 :APTAYLPEVFNQPRITSQKSRPAKRKKR :Sequence