[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49055.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1------------------------------------------------------------------------------------------------------12-1------------11------------11--131--111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTKTLELIFVNVAGDKVTLRVNDPRDDLQEAEVRTVMDTVVAKNVFTSTGGSLTGVAGAR:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->69|PF11148|1e-09|47.8|67/69|DUF2922 61: . . . * . .: 120 :LVTRDVAELNIL :Sequence :$$$$$$$$$ :RP:PFM|3->69|PF11148|1e-09|47.8|67/69|DUF2922