[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49099.1"

            "conserved hypothetical protein"
            ""

OrgPattern ---------------------------1----------1-----1-1211131---1----------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------1--------111----111111---1111--221---11------1-------------------------1----1---------------------1-----------------------------1---1---------------------------1----------------------------------------------------------------------------------------------1-----------------------------------------1111---------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNCDCGCSSAPVLFFSCSGGSNVGQIANDVCRQLTMDGQGKLFCLAGVGGKIGSFVEKA:Sequence : TccTTccEEEEcccTTcTTHHHEEE:Sec Str : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->101|PF08859|3e-21|50.0|88/110|DGC 61: . . . * . .: 120 :KDGSKVIVIDGCNLHCARKILENADIPINTHIVLTDLGVAKNNNLINEQTVIHENKVKIL:Sequence :EEccccEEEEETTEEEEEEcHHHHHTccTTcEEEE EEEcccEEEEEccccTTcEEEccc:Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|14->101|PF08859|3e-21|50.0|88/110|DGC 121: . . + . . .: 180 :QIIMENNK :Sequence : :Sec Str