[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49099.1 dred0 ABO49099.1 "conserved hypothetical protein"
MSNCDCGCSSAPVLFFSCSGGSNVGQIANDVCRQLTMDGQGKLFCLAGVGGKIGSFVEKA
KDGSKVIVIDGCNLHCARKILENADIPINTHIVLTDLGVAKNNNLINEQTVIHENKVKIL
QIIMENNK
//