[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49162.1"

            "protein of unknown function UPF0126"
            ""

OrgPattern ------1111111111-1-1111---------------11111------------------------1 -1-----11111-11------------------111-111-------1----1---11----2---1121-1111111---11-111-1111-111---111111--111----------------------------------1--------------------------------------11------111222222222222222-111-12221111-11-------1-------------------------------------------1111111111--------------1111111111111-1----111-----1----------2--------------------1---------------------------1--1--1--1-11111111111---1------11-----11111111-11-1-111111111--------1------1-----------------------------------111112112121221222221111-1131------12-1--111-----11-----11---------1-11---------12----11111-111-212-----11-1111111-1-------1-111--221-1-212312222212222222222222--1-1--------22112212222222222-2222222222222222222222111112222222222222222222222221-222222212222---------1111--1111111-1-111112211111111121--11111221111111111---------1222222222222221111111111--------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------1----------------2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTLLSLLDMIGTFAFALTGALVAVRKEMDLYGILLLSFVTAIGGGTTRDLLLGNTPVFFL:Sequence : ==========================================================:BL:SWS|3->190|YADS_AERPU|4e-25|36.4|184/210 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->78|PF03458|8e-11|44.0|75/81|UPF0126 61: . . . * . .: 120 :NQPSYFYISLLAGFCTFLFHKELFKINSIILILDALGLGLFVCVGVSIALSAHISFTGAV:Sequence : XXXXXXXXXXXX :SEG|89->100|iilildalglgl : XXXX:SEG|117->133|tgavilgvvtgtvggii :============================================================:BL:SWS|3->190|YADS_AERPU|4e-25|36.4|184/210 :$$$$$$$$$$$$$$$$$$ :RP:PFM|4->78|PF03458|8e-11|44.0|75/81|UPF0126 121: . . + . . .: 180 :ILGVVTGTVGGIIRDLLAGEIPTVLVKDFYALICVVGGILYVYLHHLNVPHDITLLVSAS:Sequence :XXXXXXXXXXXXX :SEG|117->133|tgavilgvvtgtvggii :============================================================:BL:SWS|3->190|YADS_AERPU|4e-25|36.4|184/210 181: . * . . . .: 240 :VIFFLRLAAIKLKWNFVKASRSSLLQ :Sequence :========== :BL:SWS|3->190|YADS_AERPU|4e-25|36.4|184/210