[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49162.1 dred0 ABO49162.1 "protein of unknown function UPF0126"
MTLLSLLDMIGTFAFALTGALVAVRKEMDLYGILLLSFVTAIGGGTTRDLLLGNTPVFFL
NQPSYFYISLLAGFCTFLFHKELFKINSIILILDALGLGLFVCVGVSIALSAHISFTGAV
ILGVVTGTVGGIIRDLLAGEIPTVLVKDFYALICVVGGILYVYLHHLNVPHDITLLVSAS
VIFFLRLAAIKLKWNFVKASRSSLLQ
//