[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49306.1"

            "protein of unknown function UPF0118"
            ""

OrgPattern -----------------------1--------1-1----1-1--------111--------------- -21-22-11111-2-------1-----------111-----1112---11121111-----------211--------11122-----1111-111----1111-33211--------------1-----1---1-22213---4-325411211--------122-3252---11-1---11312----111433333333333333322443333311123332333331122222222222222222222513322321112211222122222222222222222222222222222122122222212422221222213234333333333323112544342212321-11123221212221-12--31---1111111------------1111111111-22122121321-11111111211122---113121111111111111111-21211111111111---------------111----1--------------------1----------111-1111-1-1----1---11---11-1-------11-11--111-13--1------3-1333-1121131--1---1-------------------2--11122111-111222212222221211222--25112------21---3-3333333333-3333333333333333331222--111212122222212221122323333--111111111111--12---1-11111112-11111111-1112211111111111112222111121111211111111111111111111111111122221221111-1---1-111111-------------------------------------11--1-1-1-11 ------------------------------------------------------------------------------------------------------------1------------------------------------------------------1------1-----------------2-----2111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAWWKEKCTYRYLFLSFLIGLILFFLYLIRGLFVPFILAIVLVYMLNPLVERMEKRGSPR:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|12->33|ylflsfliglilfflylirglf : ============:BL:SWS|49->335|YRRI_BACSU|2e-41|31.9|285/353 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->335|PF01594|4e-37|35.7|300/328|UPF0118 61: . . . * . .: 120 :VVAILILYLGVVIVATSLLMYGVPRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFADSSM:Sequence :============================================================:BL:SWS|49->335|YRRI_BACSU|2e-41|31.9|285/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->335|PF01594|4e-37|35.7|300/328|UPF0118 121: . . + . . .: 180 :PPGVQQIVDERIRWVESRVLAIVRKSMDLLMALLSNLFYIALAPVLAFYIMKDLKLIKNW:Sequence :============================================================:BL:SWS|49->335|YRRI_BACSU|2e-41|31.9|285/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->335|PF01594|4e-37|35.7|300/328|UPF0118 181: . * . . . .: 240 :TRSIVPKELVEDVFYLARKVDDVFSNFIRGHLTVVVIVGILSSLAFMVIGLEFAAMFGII:Sequence : XXXXXXXX:SEG|233->244|faamfgiiagia :============================================================:BL:SWS|49->335|YRRI_BACSU|2e-41|31.9|285/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->335|PF01594|4e-37|35.7|300/328|UPF0118 241: + . . . . *: 300 :AGIAELIPYFGPLIGAAPAVGIALLHSKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGL:Sequence :XXXX :SEG|233->244|faamfgiiagia :============================================================:BL:SWS|49->335|YRRI_BACSU|2e-41|31.9|285/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->335|PF01594|4e-37|35.7|300/328|UPF0118 301: . . . . + .: 360 :HPLVIIVALLAGGHLFGIAGMLLAVPLAAIIKIIVSFVWRKLI :Sequence :=================================== :BL:SWS|49->335|YRRI_BACSU|2e-41|31.9|285/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|34->335|PF01594|4e-37|35.7|300/328|UPF0118