[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49306.1 dred0 ABO49306.1 "protein of unknown function UPF0118"
MAWWKEKCTYRYLFLSFLIGLILFFLYLIRGLFVPFILAIVLVYMLNPLVERMEKRGSPR
VVAILILYLGVVIVATSLLMYGVPRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFADSSM
PPGVQQIVDERIRWVESRVLAIVRKSMDLLMALLSNLFYIALAPVLAFYIMKDLKLIKNW
TRSIVPKELVEDVFYLARKVDDVFSNFIRGHLTVVVIVGILSSLAFMVIGLEFAAMFGII
AGIAELIPYFGPLIGAAPAVGIALLHSKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGL
HPLVIIVALLAGGHLFGIAGMLLAVPLAAIIKIIVSFVWRKLI
//