[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49390.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSEVVNFSSKMDADVREKLNNLAEQSGLTLKDFMGRLVVSYETAQERESMGQVKELENLR:Sequence 61: . . . * . .: 120 :HHLARVEEVYISMVKAARDRQEVDAARISNAEADAQAAKAEAHEREKMAAEAIDSANERV:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|91->112|aeadaqaakaeaherekmaaea 121: . . + . . .: 180 :QQAEAQAALIREQTDKELNEMREALSREKEAREQSARLAGLAEQAASAAQEKAEALEEQA:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXX:SEG|156->184|arlaglaeqaasaaqekaealeeqakkae 181: . * . . . .: 240 :KKAEQYRQERDELVQDKKAWKDKVEQLQAQLEQTRVEAQKELNAQADRVKEKIERLNEQH:Sequence :XXXX :SEG|156->184|arlaglaeqaasaaqekaealeeqakkae : ==============================================:BL:SWS|195->288|TSG10_RAT|4e-05|40.5|74/712 241: + . . . . *: 300 :NEAMTRALEKAEVEKEKAVLLAQREFMKEIAGLRESLAQCREEKAQFEAQVTVMQSKREQ:Sequence : XXXXXXXXXXXXXXXX :SEG|247->262|alekaevekekavlla :================================================ :BL:SWS|195->288|TSG10_RAT|4e-05|40.5|74/712 301: . . . . + .: 360 :DNNLI :Sequence