[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49390.1 dred0 ABO49390.1 "hypothetical protein"
MSEVVNFSSKMDADVREKLNNLAEQSGLTLKDFMGRLVVSYETAQERESMGQVKELENLR
HHLARVEEVYISMVKAARDRQEVDAARISNAEADAQAAKAEAHEREKMAAEAIDSANERV
QQAEAQAALIREQTDKELNEMREALSREKEAREQSARLAGLAEQAASAAQEKAEALEEQA
KKAEQYRQERDELVQDKKAWKDKVEQLQAQLEQTRVEAQKELNAQADRVKEKIERLNEQH
NEAMTRALEKAEVEKEKAVLLAQREFMKEIAGLRESLAQCREEKAQFEAQVTVMQSKREQ
DNNLI
//