[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49466.1 dred0 ABO49466.1 "hypothetical protein"
MKEMTLLLVVFIFILLLLGAAMVMIWYLNRGKDKSVQNSIEFSHESEEVLEITHKKPDKN
YQHISELINTEVVEPGIYYTGGKYLGLARIEGTNFSILSDGEIEAREDMLIAIQNQIKYP
VQYITSTIVTDTDREVEKIQYHAGKTTNHKVSLYCKQYIMELENMKQERRAMAKVSWLVI
SGDDKLGAPGNPVQRIKERMALLQETFRSRAGIIMTPLTSTEEVVDAFQQIMQPEKLVKP
SEVARLCMHPIKFNIKEIADIAT
//