[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49520.1 dred0 ABO49520.1 "hypothetical protein"
MTESMKNSFLTKVALQAETNRLVKGEQDLPMEKWAMIAGEHMGHLFAAVMDGDRDRVEKE
LLHVTAPLLELYQGMMTTDSYPSK
//