[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49533.1"

            "YD repeat protein"
            ""

OrgPattern --------------------------------------------------21---------------- ----1---------------------------------1----1-----------------------1----------------------1-----1---------------------------2------------------1------1--------------------------------------------------------------1-------1-------1-1-------------------------------------------------------------------------------------------2---1-------1------------5---------11--1------1----------------------------------------------------------------------------------------------------------------------------------------------1111--1-1711112----1-----1---------------------------112----7-2------------2-1--2-1-----8-2--------------------------------1-------4441---------1--1-----------------------------------------------------1-7B--6--------1-1--11----------65656636A43---------------5----------------------------2----416--1-11-46C-------------------1-----------114------------11--------4---------------------------------------3 -------------------------------------------------4121111-----------------------------------------------------------------------------------------------------------------1----------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGNKIKSFTNQKDKSKISFTELSLPKGGGAIKGIGETFQPDPFSGTANLSIPVQMSPCRD:Sequence : :Sec Str : =====================================:BL:SWS|24->341|VRP2_SALTY|1e-43|39.2|306/591 : $$$$$$$$$$$$$$$$$:RP:PFM|44->246|PF03534|2e-33|37.9|195/211|SpvB 61: . . . * . .: 120 :FEPKISLNYNSGTGNGIFGIGFSISIPNISRKTEKGIPRYNDTDTFLFSNAEDLVSKMVK:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|70->90|nsgtgngifgigfsisipnis :============================================================:BL:SWS|24->341|VRP2_SALTY|1e-43|39.2|306/591 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->246|PF03534|2e-33|37.9|195/211|SpvB 121: . . + . . .: 180 :NQEGSWVKEERHVEENRVGWKVLSYIPRIEGLFAQIEYWQNSWESFWKVTTKDNTTSIYG:Sequence : GTTccccccc TTcccTTTTcEEccccccccTTcc:Sec Str :============================================================:BL:SWS|24->341|VRP2_SALTY|1e-43|39.2|306/591 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->246|PF03534|2e-33|37.9|195/211|SpvB 181: . * . . . .: 240 :QSENARIADPHDNTRVFKWLIEKTYDAKGNKIEYFYKQEDNENAPDNICEKNRTYATNKY:Sequence :ccEEEEEGGGTTcHHHHHHHHHHHHHHHccEEEEEcGGGGGcccEEcccccc cccEE:Sec Str :============================================================:BL:SWS|24->341|VRP2_SALTY|1e-43|39.2|306/591 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->246|PF03534|2e-33|37.9|195/211|SpvB 241: + . . . . *: 300 :VSSIKYGNYLDGKGEEAWAFEVVFDYGQYDISDQYLSQPGCNPYIPARKWPARQDPFSSY:Sequence :EEEEEEEEEEcTTccEEEEEEEEccccTT :Sec Str :============================================================:BL:SWS|24->341|VRP2_SALTY|1e-43|39.2|306/591 :$$$$$$ :RP:PFM|44->246|PF03534|2e-33|37.9|195/211|SpvB 301: . . . . + .: 360 :RSGFEIRTLRLCRNILMFHHFKKELGETPCLVKATQLTYREPAQQLQNSNNPFTKILQLS:Sequence : :Sec Str :========================================= :BL:SWS|24->341|VRP2_SALTY|1e-43|39.2|306/591 361: . . . * . .: 420 :QVELKGFKRKENGSYQFRSMPSLKLTYSCLMPAGGKFDTLKVGNSTAVPVSTGQIRYNFV:Sequence : EEEccccccccccccEEEEccccTTcccccTTTE:Sec Str : ====:RP:SCP|417->655|1jv2A4|2e-08|15.5|233/438|b.69.8.1 421: . . + . . .: 480 :DLYGDGIPGLLYSDDKATLYWKPKGNGEYEYPEPAAQFPIEKDLKKGEYTLVSLEGNGRL:Sequence :ccccccccEEEEEccccEEEEccccTTcccccEEEEccccGGGTccTTTcEEEccccccc:Sec Str :============================================================:RP:SCP|417->655|1jv2A4|2e-08|15.5|233/438|b.69.8.1 481: . * . . . .: 540 :DLVVGTPQRGGFYEGNPDGSWHSYRDFATYPLDFTNSHKEMIDMNGDGLADLLLYEDNTA:Sequence :EEEEEccccEEEEcccccccccccEEEEcccccTTTccEEEEccccccccEEEEEccccE:Sec Str :============================================================:RP:SCP|417->655|1jv2A4|2e-08|15.5|233/438|b.69.8.1 541: + . . . . *: 600 :KIYPSLKKKGYGIPTRASLSEDYPTTSNGYAEEVLSYADMFGDGMAHRVRIRNGSVECWP:Sequence :EEEcccccccccccEEEEccccGGGTccTTTccEEEEEcccTTcccEEEEEccccEEEEc:Sec Str :============================================================:RP:SCP|417->655|1jv2A4|2e-08|15.5|233/438|b.69.8.1 601: . . . . + .: 660 :NLGHGRFGKRVLFANAPRFGDTLDASRLFLADLDGTGMTDLIYAYPDKVQVFFNQGGNSF:Sequence :ccccccccccEEEEccccGTccTTTccEEEEccccccccEEEEEccccEEEEEEcccccE:Sec Str :======================================================= :RP:SCP|417->655|1jv2A4|2e-08|15.5|233/438|b.69.8.1 661: . . . * . .: 720 :SPPLSIPLPETYSNLDQLGFADVKGNGTACLVFIKTGANAKQYYYDFSEGTKPYLLTGID:Sequence :EEEEEEEccccGGGTccTTcEEEEEcc :Sec Str : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|664->840|PF12256|5e-27|44.2|156/167|TcdB_toxin_midN 721: . . + . . .: 780 :NNLGALTNIKYTSSVKYYLHDKMAGKPWKTKLPFPVQVVEKVESIDKISGLKLTTQYKYH:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|664->840|PF12256|5e-27|44.2|156/167|TcdB_toxin_midN 781: . * . . . .: 840 :DGFYDSVEREFRGFGFVEETDSEDFFTYAKPGLLENVAFYGLEEEHHVPPVLTKRWYHIG:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|787->799|verefrgfgfvee :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|664->840|PF12256|5e-27|44.2|156/167|TcdB_toxin_midN 841: + . . . . *: 900 :ACIEEGVVSKQCEKEYYQQDKRGFSIPDSTFDDVVRQGCAETLRQAYRALKGQVIREEVY:Sequence : :Sec Str : $$$$$$$$$$$$$:RP:PFM|888->987|PF12255|8e-21|45.5|99/148|TcdB_toxin_midC 901: . . . . + .: 960 :ALDYIEGRTGHPYTVTETNFHVRLIQPLIGENRAVFSVYKKETVSFNYERNPNDPQIQHE:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|888->987|PF12255|8e-21|45.5|99/148|TcdB_toxin_midC 961: . . . * . .:1020 :FILAVDDFGNVKKSCRVFYPRRATPKDAVSVVHPEQTKIKAIVDLHSFINNSLDFWLLGI:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|888->987|PF12255|8e-21|45.5|99/148|TcdB_toxin_midC 1021: . . + . . .:1080 :SYESKTLEIGALDLQGQACFSFTKIKDQVGRALQNCIRNDEKFSSDKVQARLLSWERNYF:Sequence : :Sec Str 1081: . * . . . .:1140 :WNEAQDAPLPLGQITDKALLHHSEEAVFSQELLNTVFNGKATIDMLEKEGGYAFQEGYWW:Sequence : :Sec Str 1141: + . . . . *:1200 :NRGLVQHYLKDRFLLPWKTENSYTSFPSSLYAKAVYEYDQYSLAPVKATKFITDKITNTS:Sequence : :Sec Str 1201: . . . . + .:1260 :SALLDYTILLPVQITDINDNVSQAFFDPLGMVIATSVFGTMGGKPAGDRDLKEYKAIPQV:Sequence : :Sec Str 1261: . . . * . .:1320 :DTTFDDVLANPHKYLQDATTYFYYDLSAWKNKGQPARSVQLTRETHVSDLAAGEKSGMHI:Sequence : :Sec Str 1321: . . + . . .:1380 :QINYSDGFGREIEKKLKADAGEAVLRDNAGKPVYDAAGKIVKDFAQDRWIVSGRTVYNNK:Sequence : :Sec Str 1381: . * . . . .:1440 :AKPIKQFIPYFSATPDYELQKDIDPILPKPTIIYYDPLLRVVKTVNPKGFFSKVEFTPWE:Sequence : :Sec Str 1441: + . . . . *:1500 :EKHFDENDTVRDSVYFKNFKETYSKDPSQEQRDEKDALDKASRSYNTPDTKVLDNTGQTF:Sequence : :Sec Str 1501: . . . . + .:1560 :LEIRNNLGEITKDILQDIVKGTEVNCQELWDELKSKGYIETGDPPSAMGWVSGKFRPYFK:Sequence : :Sec Str 1561: . . . * . .:1620 :GFMLGLDGRYKQFEEKIINLLKENCLTTYHELDIQGNVLFSVDPRLYYSNLKDHTDYYNF:Sequence : :Sec Str 1621: . . + . . .:1680 :KYVYDMQKKPLSVDSADAGLKLSLSNIFGNTVHSWDSRGFHTRKMYDSLQRCVQIGVEGN:Sequence : :Sec Str 1681: . * . . . .:1740 :DGRGLVLHQAVEKFVYGEFYEEKEEASKDKNLRGQVYKHFDQAGVVTCNLYNLKGKAVQT:Sequence : TTEEEEE:Sec Str : =========================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 1741: + . . . . *:1800 :DRQFLADYKKEANWDNVNKSSLADELFSIGCSYDALERVISETAPDGSIYTHIYNQAGLL:Sequence :EccccTTEEEEEEETT EEEEEEEccTTccEEEEEEcTTccEEEEEEEcTTccE:Sec Str :============================================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 1801: . . . . + .:1860 :RKVVVAFKDGSEEEFIKDIQYNANGQRLKIIYGNGVTTEYSYTDPALRLTDILSLKPDSN:Sequence :EEEEEEETTccEEEEEEEEcTTccEEEEEEEcccccEEEEEEccTTccEEEEEEcTTccE:Sec Str :============================================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 1861: . . . * . .:1920 :NTKDFKGCLLQKIHYTYDPVGNVTRLRDNSYPTVFYNQQKVEPLSDYSYNPLYQLVSATG:Sequence :EEEEcTTccEEEEEEcTTccEEEEEEEcTTccEEEEEEEEcTTccEEEEcTTccEEEEEE:Sec Str :============================================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 1921: . . + . . .:1980 :RQHPGIFDGSHRDGFKQSKFIPIKSSNPNDGTSLENYRQDYQYDEAGNLTNIRHISSSTS:Sequence :EcTTcTccEEEEEEccccEEEEEcccEEEEEEEETTEEEEEEEETTccEEEEEEEccccT:Sec Str :============================================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 1981: . * . . . .:2040 :WTRQLDISKGTNRTVQIASLNGAKNFFKTAYDPCGNMLNLENLASINWSYRNNLSRVDVI:Sequence :TTcEEEEEETTTTEEEETTEEEEEEEEcTTccTTccccccccEEEccHHHHHHHHc :Sec Str :============================================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 2041: + . . . . *:2100 :LRENNSSDSEYFIYDSSGQRVRKVSERKCGSLREIEEKLYLGNFEIKRIKKKSDHLESQI:Sequence : :Sec Str :============================================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 2101: . . . . + .:2160 :LDRQSLHIMDGKSRIAITDIWLKDDLNRETEKTMERKFRYQLNNNLGSACLEVDEKVNII:Sequence : :Sec Str :============================================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 2161: . . . * . .:2220 :SCEEYFPYGGTSFIAGRDKREVKLKEYRYCGKERDDSTGFYYYGARYYLPWLGRWINPDP:Sequence : :Sec Str :============================================================:BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 2221: . . + . . .:2280 :AGTVDGLNLYSFVKGNPVNFIDTSGKVGGSWLHLLYGGLTALAVGLIGGAAVGTGDYASP:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|2257->2275|ggltalavgliggaavgtg : ############# :PROS|2242->2254|PS00213|LIPOCALIN|PDOC00187| :========================= :BL:SWS|1700->2245|WAPA_BACSU|5e-13|25.6|504/2334 2281: . * . . . .:2340 :VVAALAGLAGMLFNKDKSALGALAIAGAGAIGSAVGGYVGRGTMSKLKEKDWQTTSVART:Sequence : :Sec Str :XXXXXXXXXX :SEG|2281->2290|vvaalaglag : XXXXXXXXXXXXXXXXXXXXXXX :SEG|2298->2320|salgalaiagagaigsavggyvg 2341: + . . . . *:2400 :GLVASGLTGGTIGSLGVLAVQAVTRQFNTHNILMGAIAGFGGGILASGAQFGLFKPGDAK:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|2345->2356|sgltggtigslg : XXXXXXXXXXXXXXX :SEG|2375->2389|gaiagfgggilasga 2401: . . . . + .:2460 :VPTMPVRAELKDLLPYQTRAFDRHYLELNPNPEELITNLKPKHFTVIDEETQQRVKCDLV:Sequence : :Sec Str 2461: . . . * . .:2520 :AVHGYPRFSFVQSVHGDYNQYIDKEKLVQLLQQAGFPHQDSTTGKNIPIKLATCFGGFWE:Sequence : :Sec Str 2521: . . + . . .:2580 :SWFSTAQLVADKLGTEVYAHRWPVTVAQQSPWKKFTPN :Sequence : :Sec Str