[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49533.1 dred0 ABO49533.1 "YD repeat protein"
MGNKIKSFTNQKDKSKISFTELSLPKGGGAIKGIGETFQPDPFSGTANLSIPVQMSPCRD
FEPKISLNYNSGTGNGIFGIGFSISIPNISRKTEKGIPRYNDTDTFLFSNAEDLVSKMVK
NQEGSWVKEERHVEENRVGWKVLSYIPRIEGLFAQIEYWQNSWESFWKVTTKDNTTSIYG
QSENARIADPHDNTRVFKWLIEKTYDAKGNKIEYFYKQEDNENAPDNICEKNRTYATNKY
VSSIKYGNYLDGKGEEAWAFEVVFDYGQYDISDQYLSQPGCNPYIPARKWPARQDPFSSY
RSGFEIRTLRLCRNILMFHHFKKELGETPCLVKATQLTYREPAQQLQNSNNPFTKILQLS
QVELKGFKRKENGSYQFRSMPSLKLTYSCLMPAGGKFDTLKVGNSTAVPVSTGQIRYNFV
DLYGDGIPGLLYSDDKATLYWKPKGNGEYEYPEPAAQFPIEKDLKKGEYTLVSLEGNGRL
DLVVGTPQRGGFYEGNPDGSWHSYRDFATYPLDFTNSHKEMIDMNGDGLADLLLYEDNTA
KIYPSLKKKGYGIPTRASLSEDYPTTSNGYAEEVLSYADMFGDGMAHRVRIRNGSVECWP
NLGHGRFGKRVLFANAPRFGDTLDASRLFLADLDGTGMTDLIYAYPDKVQVFFNQGGNSF
SPPLSIPLPETYSNLDQLGFADVKGNGTACLVFIKTGANAKQYYYDFSEGTKPYLLTGID
NNLGALTNIKYTSSVKYYLHDKMAGKPWKTKLPFPVQVVEKVESIDKISGLKLTTQYKYH
DGFYDSVEREFRGFGFVEETDSEDFFTYAKPGLLENVAFYGLEEEHHVPPVLTKRWYHIG
ACIEEGVVSKQCEKEYYQQDKRGFSIPDSTFDDVVRQGCAETLRQAYRALKGQVIREEVY
ALDYIEGRTGHPYTVTETNFHVRLIQPLIGENRAVFSVYKKETVSFNYERNPNDPQIQHE
FILAVDDFGNVKKSCRVFYPRRATPKDAVSVVHPEQTKIKAIVDLHSFINNSLDFWLLGI
SYESKTLEIGALDLQGQACFSFTKIKDQVGRALQNCIRNDEKFSSDKVQARLLSWERNYF
WNEAQDAPLPLGQITDKALLHHSEEAVFSQELLNTVFNGKATIDMLEKEGGYAFQEGYWW
NRGLVQHYLKDRFLLPWKTENSYTSFPSSLYAKAVYEYDQYSLAPVKATKFITDKITNTS
SALLDYTILLPVQITDINDNVSQAFFDPLGMVIATSVFGTMGGKPAGDRDLKEYKAIPQV
DTTFDDVLANPHKYLQDATTYFYYDLSAWKNKGQPARSVQLTRETHVSDLAAGEKSGMHI
QINYSDGFGREIEKKLKADAGEAVLRDNAGKPVYDAAGKIVKDFAQDRWIVSGRTVYNNK
AKPIKQFIPYFSATPDYELQKDIDPILPKPTIIYYDPLLRVVKTVNPKGFFSKVEFTPWE
EKHFDENDTVRDSVYFKNFKETYSKDPSQEQRDEKDALDKASRSYNTPDTKVLDNTGQTF
LEIRNNLGEITKDILQDIVKGTEVNCQELWDELKSKGYIETGDPPSAMGWVSGKFRPYFK
GFMLGLDGRYKQFEEKIINLLKENCLTTYHELDIQGNVLFSVDPRLYYSNLKDHTDYYNF
KYVYDMQKKPLSVDSADAGLKLSLSNIFGNTVHSWDSRGFHTRKMYDSLQRCVQIGVEGN
DGRGLVLHQAVEKFVYGEFYEEKEEASKDKNLRGQVYKHFDQAGVVTCNLYNLKGKAVQT
DRQFLADYKKEANWDNVNKSSLADELFSIGCSYDALERVISETAPDGSIYTHIYNQAGLL
RKVVVAFKDGSEEEFIKDIQYNANGQRLKIIYGNGVTTEYSYTDPALRLTDILSLKPDSN
NTKDFKGCLLQKIHYTYDPVGNVTRLRDNSYPTVFYNQQKVEPLSDYSYNPLYQLVSATG
RQHPGIFDGSHRDGFKQSKFIPIKSSNPNDGTSLENYRQDYQYDEAGNLTNIRHISSSTS
WTRQLDISKGTNRTVQIASLNGAKNFFKTAYDPCGNMLNLENLASINWSYRNNLSRVDVI
LRENNSSDSEYFIYDSSGQRVRKVSERKCGSLREIEEKLYLGNFEIKRIKKKSDHLESQI
LDRQSLHIMDGKSRIAITDIWLKDDLNRETEKTMERKFRYQLNNNLGSACLEVDEKVNII
SCEEYFPYGGTSFIAGRDKREVKLKEYRYCGKERDDSTGFYYYGARYYLPWLGRWINPDP
AGTVDGLNLYSFVKGNPVNFIDTSGKVGGSWLHLLYGGLTALAVGLIGGAAVGTGDYASP
VVAALAGLAGMLFNKDKSALGALAIAGAGAIGSAVGGYVGRGTMSKLKEKDWQTTSVART
GLVASGLTGGTIGSLGVLAVQAVTRQFNTHNILMGAIAGFGGGILASGAQFGLFKPGDAK
VPTMPVRAELKDLLPYQTRAFDRHYLELNPNPEELITNLKPKHFTVIDEETQQRVKCDLV
AVHGYPRFSFVQSVHGDYNQYIDKEKLVQLLQQAGFPHQDSTTGKNIPIKLATCFGGFWE
SWFSTAQLVADKLGTEVYAHRWPVTVAQQSPWKKFTPN
//