[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49594.1"

            "putative sporulation protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------111111111111111111111111-1--1111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDILQIVGLGLVVCILAIILRQQKPPMATLLTMTAGIIIFFAMMSQITAVFNVLRDLASQ:Sequence :============================================================:BL:SWS|1->128|SP3AD_BACSU|2e-35|50.0|128/133 61: . . . * . .: 120 :ANVSMVYMGTILKIVGIAYIADFGSQICRDAGESALASKIEFAAKIIVLVMAVPIIVAVL:Sequence :============================================================:BL:SWS|1->128|SP3AD_BACSU|2e-35|50.0|128/133 121: . . + . . .: 180 :QSLIKLVP :Sequence :======== :BL:SWS|1->128|SP3AD_BACSU|2e-35|50.0|128/133