[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49594.1 dred0 ABO49594.1 "putative sporulation protein"
MDILQIVGLGLVVCILAIILRQQKPPMATLLTMTAGIIIFFAMMSQITAVFNVLRDLASQ
ANVSMVYMGTILKIVGIAYIADFGSQICRDAGESALASKIEFAAKIIVLVMAVPIIVAVL
QSLIKLVP
//