[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49673.1"

            "PAS/PAC sensor signal transduction histidine kinase"
            ""

OrgPattern -----------------------5D3224B4C--11-1222241G-367GC27--------------9 Lm*2832322342212211-17113711111394344585477562121323366314--34D16-647A3----11123E5232577WViU-d441--A5R6DDicgRb111111111111112772B746DKU6hecdcH7Bp2*OkhPPBA868222422HNAR***M131311141221IB733254DGHYYZXZVWUIWXZccVGJFFFFYZdCHIH8HF766666pi4555555555555555443465744444334664465554564332565344321122222222222222222222322221122111155ZHGkNMLRMNQKKFFJNM9AC8JCJ33AACF7cXWMFC37A49794214XOTTQQQ56666MKjfgJBCWZUVVBBBBABBBBAH-pgnfcdqnEUT4LSSMURMVgVMNQPEEKE9IFGGFAOF7777777778777uMM3333333333492222222223222222236CI856764CSMNQSNIEDECONWdIJJJ9HMRSLPOT25HJDSOMABPOOUKBDIT9IFHGA222222346DKZzZ**VOP*Z9**gde3****o**Ksfglj**MuD24322222---11111111GH33D98KG9XLWQ9XJFMGIJIHIKIIGGOJJOISQ--3CFAE------F8B7A97DCCFDGDGCD-CEECEEECCCCECBCDCCCGEGAA888DBCCBCCBBCCECFCCEBA9BABD6-CCCDEDDBBEEE--36566568989ACg8S222312-----12359B99B69153IFOQRNSddZLYVZdWbac2112-11-1BGHHNMMLMMKQPTUFFOKOJKDFF433311u4ffGKNN11-111113-1-------------------------58444444444p3 --1-47-------1733321231213211----11112321232221233312122121333------------------------22-22-323-1111221336-5-41-----------------------------------------------2--------------1--324A----1A-183-32-3---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIDRLISVPHLNQLVLYSIWEKFINGQRIETKDLFSETYKAWLRCVEYRINPYQITTESL:Sequence : :Sec Str : XXX:SEG|58->66|eslseeels : =========================================:BL:SWS|20->197|ACOR_BACSU|3e-12|22.2|176/605 61: . . . * . .: 120 :SEEELSYRKSKLTDMLELLTPHIETIKTTLSTHSDTFLILITDHEGFILESFTGKDSTKD:Sequence : :Sec Str :XXXXXX :SEG|58->66|eslseeels : ===============================================:RP:SCP|74->213|1mkmA2|2e-06|17.4|138/171|d.110.2.2 :============================================================:BL:SWS|20->197|ACOR_BACSU|3e-12|22.2|176/605 121: . . + . . .: 180 :LINVPYAPGIGYAEHLAGNNGIGSVLATGIPLAVLGAEHFVKDFHRWSCVGSPIIGDKGD:Sequence : cGGGGcccHHHHHHHHHHHHHHHHHHHTcccHHHHHccccHHHHHHHH:Sec Str :============================================================:RP:SCP|74->213|1mkmA2|2e-06|17.4|138/171|d.110.2.2 :============================================================:BL:SWS|20->197|ACOR_BACSU|3e-12|22.2|176/605 181: . * . . . .: 240 :IIAVLGVFMPCGMESPYTFSLTVAATKAVEAAIKQGQMEKQLQDTRKTLRNLMQQRNIIF:Sequence :HHHHEEHHHHHHHHHHHHHccccccTTTccccHHHHHHHHHHTTcccHHHHHHHHHHHHH:Sec Str :================================= :RP:SCP|74->213|1mkmA2|2e-06|17.4|138/171|d.110.2.2 :================= :BL:SWS|20->197|ACOR_BACSU|3e-12|22.2|176/605 : ===========================:BL:SWS|214->577|ATOS_ECOLI|4e-51|32.6|356/608 241: + . . . . *: 300 :NAMSQGVIILNHEGIVTFFNKAAEEIWHINADELVGRPFFCFSRCRRAEPLLIRSLKEAN:Sequence :HHHHHHHHHHTTccHHHHTcHHHHHHHTcccccccHHHHHHHTTcGGGHHHHHHHHHHHH:Sec Str : ===========================================================:RP:SCP|242->346|1p97A|5e-13|8.6|105/114|d.110.3.7 :============================================================:BL:SWS|214->577|ATOS_ECOLI|4e-51|32.6|356/608 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|241->344|PF08448|7e-06|27.9|104/111|PAS_4 301: . . . . + .: 360 :SFTNIECKCSNLLHEKYILVNISLLRDEKNAVSGAIGIYTDVTELRRQEARIREQEKLAV:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHTcHHHHHHHHHHHHHHHHHHGTTcHHH:Sec Str :============================================== :RP:SCP|242->346|1p97A|5e-13|8.6|105/114|d.110.3.7 : =======================================:RP:SCP|322->423|1csgA|5e-17|12.0|100/120|a.26.1.2 :============================================================:BL:SWS|214->577|ATOS_ECOLI|4e-51|32.6|356/608 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|241->344|PF08448|7e-06|27.9|104/111|PAS_4 361: . . . * . .: 420 :VGQMAAGMAHEIRNPLTSVRGFAQLMSEKMAEEQNPYKEFMEIMIQEIDQADSFINNFLQ:Sequence :HHHHHHHHHHHHHHTTTHHHHHHHHHHHHccccccTTHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|322->423|1csgA|5e-17|12.0|100/120|a.26.1.2 :============================================================:BL:SWS|214->577|ATOS_ECOLI|4e-51|32.6|356/608 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|361->423|PF00512|1e-08|38.1|63/69|HisKA 421: . . + . . .: 480 :LARPKPPKMQACSLNQLILNFIKIFESQAFLQGVKIGIDLGEIPTIVIDKDQIKQVLLNL:Sequence :HHcccccccTTHHHHHHHHHHHHHHHcccccEEEEEEEccTcccEEEEcHHHHHHHHHHH:Sec Str :=== :RP:SCP|322->423|1csgA|5e-17|12.0|100/120|a.26.1.2 : ===================================================:RP:SCP|430->574|1id0A|6e-25|19.1|141/146|d.122.1.3 :============================================================:BL:SWS|214->577|ATOS_ECOLI|4e-51|32.6|356/608 :$$$ :RP:PFM|361->423|PF00512|1e-08|38.1|63/69|HisKA : $$$$$$$$$$:RP:PFM|471->574|PF02518|3e-15|40.2|102/112|HATPase_c 481: . * . . . .: 540 :CQNALQAMNMQGTITIATRFHAAEKEVSLSVRDNGPGIPGDNIDKLGTPFFTTKDKGTGL:Sequence :HHHHHHHHHHHTTTccccEEEEcccEEEEEEEEccccccGGGTTGGGcTTcccccccccc:Sec Str :============================================================:RP:SCP|430->574|1id0A|6e-25|19.1|141/146|d.122.1.3 :============================================================:BL:SWS|214->577|ATOS_ECOLI|4e-51|32.6|356/608 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|471->574|PF02518|3e-15|40.2|102/112|HATPase_c 541: + . . . . *: 600 :GLSISYTIVDKHQGRIEVESTIDEGTCFKVYLPVYEQF :Sequence :HHHHHHHHHHHTTcEEEEEEETTTEEEEEEEEEccTEE :Sec Str :================================== :RP:SCP|430->574|1id0A|6e-25|19.1|141/146|d.122.1.3 :===================================== :BL:SWS|214->577|ATOS_ECOLI|4e-51|32.6|356/608 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|471->574|PF02518|3e-15|40.2|102/112|HATPase_c