[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49673.1 dred0 ABO49673.1 "PAS/PAC sensor signal transduction histidine kinase"
MIDRLISVPHLNQLVLYSIWEKFINGQRIETKDLFSETYKAWLRCVEYRINPYQITTESL
SEEELSYRKSKLTDMLELLTPHIETIKTTLSTHSDTFLILITDHEGFILESFTGKDSTKD
LINVPYAPGIGYAEHLAGNNGIGSVLATGIPLAVLGAEHFVKDFHRWSCVGSPIIGDKGD
IIAVLGVFMPCGMESPYTFSLTVAATKAVEAAIKQGQMEKQLQDTRKTLRNLMQQRNIIF
NAMSQGVIILNHEGIVTFFNKAAEEIWHINADELVGRPFFCFSRCRRAEPLLIRSLKEAN
SFTNIECKCSNLLHEKYILVNISLLRDEKNAVSGAIGIYTDVTELRRQEARIREQEKLAV
VGQMAAGMAHEIRNPLTSVRGFAQLMSEKMAEEQNPYKEFMEIMIQEIDQADSFINNFLQ
LARPKPPKMQACSLNQLILNFIKIFESQAFLQGVKIGIDLGEIPTIVIDKDQIKQVLLNL
CQNALQAMNMQGTITIATRFHAAEKEVSLSVRDNGPGIPGDNIDKLGTPFFTTKDKGTGL
GLSISYTIVDKHQGRIEVESTIDEGTCFKVYLPVYEQF
//