[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49675.1"

            "nucleoside recognition domain protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-111---1-11--11111--------------------------------------1---------------1-----1--------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------11211111111111111111111111--1--11111111111111111-------------------------------------------------------------------------------------------1-------------------------------------11111------------------------1111--1111-1111---1----1----1------------1---------------1-1------1111--1----------------------------------1----1111111111111111111----1-1--------------------------------------------------------------------------------------------1-----1111-1----------------------------1-11111111111111111----------------------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYELINQISRWAIPVMLLFIPLLAFIKKVPVFETFVEGAEAGFSTAIKTIPFLTAMLVAV:Sequence : ==========================================================:BL:SWS|3->176|SPMB_BACSU|3e-48|50.0|174/100 61: . . . * . .: 120 :SIFRASGAMELLASWISPVLNMVGIPADILPHAVMRPLSGGAALGIATEIIKTHGPDSFV:Sequence :============================================================:BL:SWS|3->176|SPMB_BACSU|3e-48|50.0|174/100 121: . . + . . .: 180 :GRLVSTMQGSSDTTFYVLTLYFGSVGIRKYRYAVASGLTADFTTLIASIMICKLMF :Sequence :======================================================== :BL:SWS|3->176|SPMB_BACSU|3e-48|50.0|174/100