[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49675.1 dred0 ABO49675.1 "nucleoside recognition domain protein"
MYELINQISRWAIPVMLLFIPLLAFIKKVPVFETFVEGAEAGFSTAIKTIPFLTAMLVAV
SIFRASGAMELLASWISPVLNMVGIPADILPHAVMRPLSGGAALGIATEIIKTHGPDSFV
GRLVSTMQGSSDTTFYVLTLYFGSVGIRKYRYAVASGLTADFTTLIASIMICKLMF
//