[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49705.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFRFPLLHDPRAVLFGITLFSQNSPGLEKQLEVFANMLEATRNSLSVIRGEMHNFEASLF:Sequence 61: . . . * . .: 120 :SSLPASKTEFSTKPVGEQPVPITYTNPNQPSFEPTITLEPTVPSAPTVDAIEEINNQLEK:Sequence : ============:RP:SCP|109->148|1dg3A1|2e-04|25.0|40/300|a.114.1.1 121: . . + . . .: 180 :QLDRLAHSNPDSINEFLNDLERLIRKYR :Sequence :============================ :RP:SCP|109->148|1dg3A1|2e-04|25.0|40/300|a.114.1.1