[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49707.1"

            "Ion transport 2 domain protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTLQELFSSFAVVFVLLGTVLLFMHSFAPVTRSQERQITITLDVFHLFRHISVLLKYSLL:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|10->23|favvfvllgtvllf 61: . . . * . .: 120 :SIAQMPPLLLLFLILYGLVLSFYYWYQRMSLGLTGLLGLSILTTIISLGIIALILSPILF:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|68->80|llllflilyglvl : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|90->119|slgltgllglsilttiislgiialilspil 121: . . + . . .: 180 :MTRKYLFDDMIESRIFRIAIYSVMVPFLYIFIIHDLTPGPLVEGIMFTGIVISYYQIFRG:Sequence : :Sec Str 181: . * . . . .: 240 :IIYCLQTPRTFFSYLDSRFIPILMIVSWLFVIIFNLYTMILLVSNTNPYSFIDSTGPVTE:Sequence : HHHHHHHTHHHHHHHTcccccHHHHccHHHH:Sec Str : ===========================================:RP:SCP|198->287|1orqC|6e-06|25.0|80/223|f.14.1.1 : ================================:BL:SWS|209->291|KCO6_ARATH|1e-05|28.2|78/436 241: + . . . . *: 300 :HIRLLYFTIITFTSVGYGDITPRGNFPVFITMIISITGFLYSALFIGGLLAAFTSRSK :Sequence : HHHHHHHHHHHTTccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHT :Sec Str :=============================================== :RP:SCP|198->287|1orqC|6e-06|25.0|80/223|f.14.1.1 :=================================================== :BL:SWS|209->291|KCO6_ARATH|1e-05|28.2|78/436