[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49707.1 dred0 ABO49707.1 "Ion transport 2 domain protein"
MTLQELFSSFAVVFVLLGTVLLFMHSFAPVTRSQERQITITLDVFHLFRHISVLLKYSLL
SIAQMPPLLLLFLILYGLVLSFYYWYQRMSLGLTGLLGLSILTTIISLGIIALILSPILF
MTRKYLFDDMIESRIFRIAIYSVMVPFLYIFIIHDLTPGPLVEGIMFTGIVISYYQIFRG
IIYCLQTPRTFFSYLDSRFIPILMIVSWLFVIIFNLYTMILLVSNTNPYSFIDSTGPVTE
HIRLLYFTIITFTSVGYGDITPRGNFPVFITMIISITGFLYSALFIGGLLAAFTSRSK
//