[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49715.1"

            "methyl-accepting chemotaxis sensory transducer"
            ""

OrgPattern -----------------------23224-1-7------4653131-16--111-2-2-31-------- -2------------------------------------------1---3-------------1-1-------------------311---------------------2-----------------------2-2-23321---21234455--1--------221-2241--------------2-----2959999AA6DA968AA76BA988899544a457111111JB--------------------------------------------------1-----------------1--1------11----------3EEHVEEEEDED9AFC-DD7---F87--14491KL8B77DB4222632---6----4-------352--111--3--------------3--1-111--366956688556--2-11--121132----------331-333-------------------------------3--286444B9A99BQ545599BD565744ABF7C79--77B64B56E149518B92615C8-------22113658A4K-352BD666-DGEG8EIAA2212I4431145-2121-2---------15341--GA-7758928-9IKIL67DFCEHADBAHEB--11288------7BRK3D83333333343-3323333333333333333---LM118555466655555554642212222--856675666776---1---------21DAJ---------------111111-11166DDCBHIEMAABCEHOMP---------83ABIFGGHG9CEKG44BBFBD6771111--4V332233111-----D1--------------------------1-83565445--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-----------2--3-----2---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSMVPSSRIKPSGSLKFQVSVFIAILLIVCVMAVSWLSISKMEKAINQKVKEGEMVASLI:Sequence : GHHcHHHHHHHHHHHHHHH:Sec Str : =======================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 61: . . . * . .: 120 :IREEIQHFLDSKGEIVKNLSLAQEFQSQDKKQILKLLLSAQNQSEFQNIYFVTGSGEITI:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHcccEEEEETTTccEEE:Sec Str : =========================================:RP:SCP|80->192|2basA2|1e-14|20.8|106/145|d.110.6.2 :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 121: . . + . . .: 180 :APVKQLPKDFDPRQRVWYQEAVKKGTMVCTDPYIDQATGKPCMTVALAVKDSEGRFVGVL:Sequence :ccTTcccccccGGGcHHHHHHHHHTccEEcccEEcTTTccEEEEEEEEEEcTTccEEEEE:Sec Str :============================================================:RP:SCP|80->192|2basA2|1e-14|20.8|106/145|d.110.6.2 :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|150->225|PF02743|7e-18|42.1|76/79|Cache_1 181: . * . . . .: 240 :GADIKLETISSLAVKYKFGEEGYFYVCDKQGKVIGHPDAKAINGDIMNRAYVKAALAGKS:Sequence :EEEEcHHHHHHHHTccccTTcEEEEEEETTccEEEcccGGGTTccHHHHcccTTcccccc:Sec Str :============ :RP:SCP|80->192|2basA2|1e-14|20.8|106/145|d.110.6.2 :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|150->225|PF02743|7e-18|42.1|76/79|Cache_1 241: + . . . . *: 300 :GFDTYADNGVKKLVYYSEIPKTGWGLFVQQPEQEAYAELYRARNMIIIITLLILASALVI:Sequence :ccEEEEETTEEEEEEEEEcTTccEEEEEEEcHHHHHHHHHHHHT :Sec Str : XXXXXXXXXXXXXXX:SEG|286->302|iiiitllilasalvisl :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 301: . . . . + .: 360 :SLYFTGKMVNVIKMVGEGARAIAQGNLTYSLTIARKDELGILSDSINEMTNHLKTIIGGV:Sequence : GGGEEEETTEEEEEcTTcTTTcccEEEEccHcTTTHHHHHHHHHHHHHHHHH:Sec Str :XX :SEG|286->302|iiiitllilasalvisl : ====================================:RP:SCP|325->400|1l8wA|3e-08|14.5|76/271|a.154.1.1 :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|307->354|PF00672|7e-04|27.1|48/69|HAMP : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|337->418|PF00015|5e-04|23.2|82/210|MCPsignal 361: . . . * . .: 420 :KDSTNRVTGACNSMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLSA:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :======================================== :RP:SCP|325->400|1l8wA|3e-08|14.5|76/271|a.154.1.1 : =============================================:RP:SCP|376->583|3cmnA1|6e-18|9.7|207/294|d.92.1.16 :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|337->418|PF00015|5e-04|23.2|82/210|MCPsignal 421: . . + . . .: 480 :QHGQEEIGEVIGAMEGIKSSTNEISRAISEVENQSKKIQHITTIITQIAEQTNLLALNAA:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|458->472|iqhittiitqiaeqt : XXXXXXX:SEG|474->486|llalnaaieaara :============================================================:RP:SCP|376->583|3cmnA1|6e-18|9.7|207/294|d.92.1.16 :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|429->584|PF00015|2e-15|35.9|156/210|MCPsignal 481: . * . . . .: 540 :IEAARAGEHGKGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNEMVE:Sequence :HHHHTTcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHH:Sec Str :XXXXXX :SEG|474->486|llalnaaieaara :============================================================:RP:SCP|376->583|3cmnA1|6e-18|9.7|207/294|d.92.1.16 :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|429->584|PF00015|2e-15|35.9|156/210|MCPsignal 541: + . . . . *: 600 :MGSQRVQEAGEVFKTITINIEELVEKMAQITRATITMSASIQNVAAASQEQAAIIEEENK:Sequence :HHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|585->598|aaasqeqaaiieee :=========================================== :RP:SCP|376->583|3cmnA1|6e-18|9.7|207/294|d.92.1.16 :============================================================:BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|429->584|PF00015|2e-15|35.9|156/210|MCPsignal 601: . . . . + .: 660 :MVEDLRQSAIVLDNMVQKFVV :Sequence :HHHHHHHHHHHHHHHHHHH :Sec Str :========= :BL:SWS|38->609|TLPA_BACSU|3e-49|27.2|562/662