[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49729.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPVKRPMLKQNKHHQPNLPTIYRESPRAIKSFWEMKAISNLDLMDDVLTLVKQKQDFISA:Sequence 61: . . . * . .: 120 :LVATYSLPDKPIIKRILGANPFEASLLSEAMQLCKNYDYAIRLYKSFKLYNLLGSNRYGY:Sequence 121: . . + . . .: 180 :EYTPDYVNRDVLQFLRDMLRVYGESGIVHMMENAKEINLKDCIRLYQQLKDENQRAIKTE:Sequence : ============================:BL:SWS|153->317|KI20B_HUMAN|2e-04|25.5|141/1820 181: . * . . . .: 240 :KVRIRDLHDWMSYRHKLQNHENLKFNVPNHIIRRLSMQNEKLKFFLPKESMELLKAGVEL:Sequence : =========================================:RP:SCP|200->262|1x9gA|7e-04|21.0|62/192|c.33.1.3 :============================================================:BL:SWS|153->317|KI20B_HUMAN|2e-04|25.5|141/1820 241: + . . . . *: 300 :HNCVASYSRAMQDNSKWVVLVANDKGKLVACLEVQGRRLIQAKIDKNKPVSSDNKLNAEV:Sequence :====================== :RP:SCP|200->262|1x9gA|7e-04|21.0|62/192|c.33.1.3 :============================================================:BL:SWS|153->317|KI20B_HUMAN|2e-04|25.5|141/1820 301: . . . . + .: 360 :ISWAKEANLEIKTNDLKVQTESATSVAV :Sequence :================= :BL:SWS|153->317|KI20B_HUMAN|2e-04|25.5|141/1820