[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49764.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAGLNALRSFLISFILLFIKDGGVMAKGGARPGAGRKPGSKSTSQPRKMRGIKVTDKEWK:Sequence : XXXXXXXXXXX :SEG|9->19|sflisfillfi : XXXXXXXXXXXXXX :SEG|26->39|akggarpgagrkpg 61: . . . * . .: 120 :KIGELAFKAGYIKPSGEPNASEYIRKRALREI :Sequence