[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49782.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTWVFFTIFCWLLALILVRQPGIKEYWPSALISLTVVYLVDSTGTYYGAYRFLNTPLING:Sequence 61: . . . * . .: 120 :VPILYLISSLALGMVTLRFYPREHREQLIYIAVLAALFLMAEIILMKTGNFIHLKGWHLG:Sequence : =========================================================:BL:SWS|64->135|T12BB_XENLA|6e-04|31.4|70/100 121: . . + . . .: 180 :KSYILNILGFIIITWISTRFGIRGAAFHWPFALR :Sequence :=============== :BL:SWS|64->135|T12BB_XENLA|6e-04|31.4|70/100