[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49801.1"

            "integral membrane sensor hybrid histidine kinase"
            ""

OrgPattern -----------------------41----2-3--12-13333559-5F7QJ6E----1-1-------1 9Vi3C67577755677755-5G3398555557EFFG59879EABA765685677A485--89P5K4BGFE8433376655KCB-57BAji*g-m113--H7WBEIuRpdm--------------1842FB7689L9yyuprN8F*3*x**rrMRRJK5665A5hpNf***V665775565765KE944573ECIjjmkmekiQmklklgIMCCDFjkrCGGdCOMCBBCBDrh8AAAAAA9AAAAAAAA998AA8C9CCA6648AA88CC879896675EEE67789668888889888834444444454448445544347CiMM*XXWbYccZZSNhaZFEJDaOS74JIVL5mkbQKA79B9DBC8149KOQgZZQ65655MFaWYLFEUSQRVDDDDCDCBDDG-VRcUUVXbGOR6ORRVTSRbYTQPDIIDRGADKDJHCJC999999996A836*VP33222222445A3355334434324222225BE5756339VQPQVUL8887RReeEDEF6GPSYKSTY-4JMBnJKGEUUNQR8HNR8HGDa4111111179OHX*T*xWHCtTB*mQPc1*r*zmmoIWfZug**Ji65531222222121111111FF53F55QH9fWeODYVGPEIIJGMHQMMFKNIOGQT--5CBME------HHCBCC9HGGIIIHJFH-GKHFHHHFGHGGHGHHHHCGHJ89CC9DDCCCDDCCBDEDECEGEECDCCH7-BDEGGFEDDGGF--5C787777677AMx8a444211-44451113EEDEF9E9B7QSTTWTTlepZWVaTXZXf3212-32-2GLJKSJLLLLNQRWWONROTOOLNK99991-*6UUABDE22212212321-------------------------6F744767574s4 --1-IH1-------MEGKGB9BDBAAA5544444445555555444ED98EEAHCD977A99432212-4123321312323334444-372G3624344763A9D-B1M------------------------------------------------A----3---------7-1578e24425*CGUIEO92F4542 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------4-

Master   AminoSeq   


1: . . . . + .: 60 :MKLKTKLFLGLSGLFIILLLISGSAIYGMKKFNNNIEEIVKNRYQKVILVATIQFEINNA:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|7->24|lflglsglfiilllisgs : ================================:RP:SCP|29->169|1jmwA|3e-08|11.3|141/146|a.24.2.1 : =======================:BL:SWS|38->187|PKHA7_HUMAN|3e-05|28.0|150/1121 61: . . . * . .: 120 :SRYLRDLILEDNNTDLEIYNKMEESNKQILGAISALEKVSEVDELKQLTTEVKTAFNEYL:Sequence : :Sec Str :============================================================:RP:SCP|29->169|1jmwA|3e-08|11.3|141/146|a.24.2.1 :============================================================:BL:SWS|38->187|PKHA7_HUMAN|3e-05|28.0|150/1121 121: . . + . . .: 180 :KIEKTIYSLVQAGRRDEAKAVLYQNASVQTRLKLVQMIDDVGSIQQKQMELTVAQSKDVY:Sequence : :Sec Str :================================================= :RP:SCP|29->169|1jmwA|3e-08|11.3|141/146|a.24.2.1 :============================================================:BL:SWS|38->187|PKHA7_HUMAN|3e-05|28.0|150/1121 : ====:BL:SWS|177->274|MCPB_BACSU|1e-04|26.3|95/662 181: . * . . . .: 240 :NNIVFIFISLVLIGMVLGSGIVVWLIQNIVGNLHRVTLAMKSVSSHKDKTFLPRLDIVSS:Sequence : :Sec Str : =======:RP:SCP|234->266|1l8wA|4e-05|12.1|33/271|a.154.1.1 :======= :BL:SWS|38->187|PKHA7_HUMAN|3e-05|28.0|150/1121 :============================================================:BL:SWS|177->274|MCPB_BACSU|1e-04|26.3|95/662 241: + . . . . *: 300 :DEIGKISEVFNDMVEALEQHARQEKEKNLAIQEQHWLKSKVAEIMTLFQGVLDVKTFAQL:Sequence : HHHHHHHHHHHHHHHTTccccHHH:Sec Str :========================== :RP:SCP|234->266|1l8wA|4e-05|12.1|33/271|a.154.1.1 : =============================:RP:SCP|272->406|1f5mA|1e-08|15.5|129/176|d.110.2.1 :================================== :BL:SWS|177->274|MCPB_BACSU|1e-04|26.3|95/662 301: . . . . + .: 360 :LITRIPPIVGGCYGVFYVSVTEGEEQRLIKMASYASGGQDVGTSSFRPGEGLVGQCLLEN:Sequence :HHHHHHHHHTcEEEEE ETTccEEEEEcccccccHHHHHHHTcccHHHHHHHTTcc:Sec Str :============================================================:RP:SCP|272->406|1f5mA|1e-08|15.5|129/176|d.110.2.1 361: . . . * . .: 420 :KVIYLTNIPNQYIHITSGLGTAPAKCITVLPVEFEGKVVAVIELASFTELSSLQQELLEQ:Sequence :ccEEEEcTTcTTccccGGTTTTTTEEEEEEEEEccccEEEEEEEEE :Sec Str : XXXXXXXXXXXX:SEG|409->420|elsslqqelleq :============================================== :RP:SCP|272->406|1f5mA|1e-08|15.5|129/176|d.110.2.1 421: . . + . . .: 480 :VRWNVGISLNRIGNHMQVQKLLADSQALTEELQTQSEELQMQQEELKTFNEKLENQYKES:Sequence : cHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|446->466|qalteelqtqseelqmqqeel 481: . * . . . .: 540 :EQKTIELQKAKTALEEQASHLALSSQYKSEFLSNMSHELRTPLNSLLILARILVENKDGN:Sequence :HHHHHHHHHHHHGGGcccTTcTTTTHHHHHHHHHHHHHTTTHHHHHHHHHHHHHHcccHH:Sec Str : ================================================:RP:SCP|493->577|2c2aA1|3e-11|21.2|85/89|a.30.2.1 : ========================================================:BL:SWS|485->903|LUXQ_VIBPA|6e-53|36.5|381/858 541: + . . . . *: 600 :LSPKQVEYAETILSSGNDLLNLINDIFDLAKIEAGKLIVKPEQISLTELIYTLERQFQPI:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccTTcHHcccEEETHHHHTTHHHHHHHG:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|552->569|ilssgndllnlindifdl :===================================== :RP:SCP|493->577|2c2aA1|3e-11|21.2|85/89|a.30.2.1 : =================:RP:SCP|584->736|1b3qA3|4e-29|19.0|153/174|d.122.1.3 :============================================================:BL:SWS|485->903|LUXQ_VIBPA|6e-53|36.5|381/858 601: . . . . + .: 660 :ARQKLLDFTIQLDNDIPKTFFTDKNRLMQILKNLLSNAFKFTNEGCVNLHVQRATKISEK:Sequence :GGccccccccHHHHHHHEHHHHHcccHHHHHHHHHHHHHHTTccEEEEEEEGGGccGGGc:Sec Str :============================================================:RP:SCP|584->736|1b3qA3|4e-29|19.0|153/174|d.122.1.3 :============================================================:BL:SWS|485->903|LUXQ_VIBPA|6e-53|36.5|381/858 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|625->736|PF02518|2e-22|49.5|107/112|HATPase_c 661: . . . * . .: 720 :GTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGGTGLGLSICRELAGLLGGFIE:Sequence :ccTcEEEEEEccccccGGGHHHHHcTTcccHHHTcccccccccHHHHHHTTcEEETTTTE:Sec Str :============================================================:RP:SCP|584->736|1b3qA3|4e-29|19.0|153/174|d.122.1.3 :============================================================:BL:SWS|485->903|LUXQ_VIBPA|6e-53|36.5|381/858 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|625->736|PF02518|2e-22|49.5|107/112|HATPase_c 721: . . + . . .: 780 :LQSIKGKGSTFSVYIPTYDVETEFIEPARTEVAPGDDNSPIERDEIGKTEEWSGDKVSLS:Sequence :EEEEEEccccEEEEEEEcHHHHHHTccEEEEccccTTTTTTcHHHHHTcccHHHHHHHHH:Sec Str :================ :RP:SCP|584->736|1b3qA3|4e-29|19.0|153/174|d.122.1.3 :============================================================:BL:SWS|485->903|LUXQ_VIBPA|6e-53|36.5|381/858 :$$$$$$$$$$$$$$$$ :RP:PFM|625->736|PF02518|2e-22|49.5|107/112|HATPase_c 781: . * . . . .: 840 :QIYSQGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDL:Sequence :HHHHHHHHHcTTcEEEEEETTEEEEEEccccTTccTHHHHHHHHcHHHHHHEEEEccHEE:Sec Str : ==================================================:RP:SCP|791->913|1a0oA|4e-27|30.3|122/128|c.23.1.1 :============================================================:BL:SWS|485->903|LUXQ_VIBPA|6e-53|36.5|381/858 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|795->908|PF00072|4e-17|44.1|111/111|Response_reg 841: + . . . . *: 900 :VLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDI:Sequence :EETTEEEEEEEEcGGGccTTGGGcEHEEEEEETTEEcccHHHHHHHHHHHHHHccccccc:Sec Str :============================================================:RP:SCP|791->913|1a0oA|4e-27|30.3|122/128|c.23.1.1 :============================================================:BL:SWS|485->903|LUXQ_VIBPA|6e-53|36.5|381/858 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|795->908|PF00072|4e-17|44.1|111/111|Response_reg 901: . . . . + .: 960 :NQLLSLMRVWLYRKVN :Sequence :cEEEEEEccGGGEEcT :Sec Str :============= :RP:SCP|791->913|1a0oA|4e-27|30.3|122/128|c.23.1.1 :=== :BL:SWS|485->903|LUXQ_VIBPA|6e-53|36.5|381/858 :$$$$$$$$ :RP:PFM|795->908|PF00072|4e-17|44.1|111/111|Response_reg