[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49801.1 dred0 ABO49801.1 "integral membrane sensor hybrid histidine kinase"
MKLKTKLFLGLSGLFIILLLISGSAIYGMKKFNNNIEEIVKNRYQKVILVATIQFEINNA
SRYLRDLILEDNNTDLEIYNKMEESNKQILGAISALEKVSEVDELKQLTTEVKTAFNEYL
KIEKTIYSLVQAGRRDEAKAVLYQNASVQTRLKLVQMIDDVGSIQQKQMELTVAQSKDVY
NNIVFIFISLVLIGMVLGSGIVVWLIQNIVGNLHRVTLAMKSVSSHKDKTFLPRLDIVSS
DEIGKISEVFNDMVEALEQHARQEKEKNLAIQEQHWLKSKVAEIMTLFQGVLDVKTFAQL
LITRIPPIVGGCYGVFYVSVTEGEEQRLIKMASYASGGQDVGTSSFRPGEGLVGQCLLEN
KVIYLTNIPNQYIHITSGLGTAPAKCITVLPVEFEGKVVAVIELASFTELSSLQQELLEQ
VRWNVGISLNRIGNHMQVQKLLADSQALTEELQTQSEELQMQQEELKTFNEKLENQYKES
EQKTIELQKAKTALEEQASHLALSSQYKSEFLSNMSHELRTPLNSLLILARILVENKDGN
LSPKQVEYAETILSSGNDLLNLINDIFDLAKIEAGKLIVKPEQISLTELIYTLERQFQPI
ARQKLLDFTIQLDNDIPKTFFTDKNRLMQILKNLLSNAFKFTNEGCVNLHVQRATKISEK
GTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGGTGLGLSICRELAGLLGGFIE
LQSIKGKGSTFSVYIPTYDVETEFIEPARTEVAPGDDNSPIERDEIGKTEEWSGDKVSLS
QIYSQGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDL
VLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDI
NQLLSLMRVWLYRKVN
//