[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49907.1"

            "extracellular solute-binding protein, family 3"
            ""

OrgPattern 11---1----------1-2222212--11-1111----7679311113-11-1----1------1--- ----432133324241111-18112B111111A66636AB14224131222-645223--112-7559472644464421321--------------------------111111111111111-----1--2-1-111221113-33553343222-------211336-------------4441133--263444447544554453332674453225544444443A4222222222222222222225647988755666668836468433388865544A9767978877784554455554554488B9988881365B453555523245332333133213233177-5121-2111111281--11114322312E6611121-115654526656L---A--91A6B11SKKHHFGJGKDGF6---13832333351111111132211134----------111111111111111--1-2-----5B99BOQQRRP99AA9IIKRBBBB8CPIS7B97-1CCD43B54C6E9JF126---1853322222---11-14B2777B44A77746155-411132-21--4-6445444443122222222-22----776-3-1---8-2111--21111311211-2-4-1-1------99FG7A97776775777-7787777677777677669HLFEC553C8798A9999A99998F766767741989999998999--31111116676--36833343522222222144444-53652-DCCD9IFK88A772DAB---------14449444446554411--------------17----11--------213-------------------------121-124212--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------1--1-----------1--2---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKRGLWFLVLVLTLALVTMGCGGGEKEKQAANQEPAKQTEKNTLDQIKEKGVIVAGLDD:Sequence : EEccTTcccccccTTcEEEEEEEcc:Sec Str : XXXXXXXXXXX :SEG|9->19|lvlvltlalvt : ==================:RP:SCP|43->274|1xt8A1|5e-48|25.5|231/248|c.94.1.1 : ====================:BL:SWS|41->275|FLIY_ECOLI|4e-47|35.9|234/266 61: . . . * . .: 120 :TFAPMGYRDESNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMT:Sequence :ccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEccccc:Sec Str : ############## :PROS|76->89|PS01039|SBP_BACTERIAL_3|PDOC00798| :============================================================:RP:SCP|43->274|1xt8A1|5e-48|25.5|231/248|c.94.1.1 :============================================================:BL:SWS|41->275|FLIY_ECOLI|4e-47|35.9|234/266 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|62->270|PF00497|5e-38|40.4|208/222|SBP_bac_3 121: . . + . . .: 180 :VTEERKKSINFSVPYVGDGQIMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGI:Sequence :ccHHHHTTEEEEEEEEEEEcEEEEEEEccccccccGGGcccEEEETTcHHHHHHHHcTTc:Sec Str :============================================================:RP:SCP|43->274|1xt8A1|5e-48|25.5|231/248|c.94.1.1 :============================================================:BL:SWS|41->275|FLIY_ECOLI|4e-47|35.9|234/266 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|62->270|PF00497|5e-38|40.4|208/222|SBP_bac_3 181: . * . . . .: 240 :KEVKLYKTYPEAFTDLQIGRIPVVVCDRITASHYISKRADTYEIVGEKITDEPLAIGLRK:Sequence :cGEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcEEEEEEccGGGcEEEEEEEEET:Sec Str :============================================================:RP:SCP|43->274|1xt8A1|5e-48|25.5|231/248|c.94.1.1 :============================================================:BL:SWS|41->275|FLIY_ECOLI|4e-47|35.9|234/266 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|62->270|PF00497|5e-38|40.4|208/222|SBP_bac_3 241: + . . . . *: 300 :SDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK :Sequence :TcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGccHH :Sec Str :================================== :RP:SCP|43->274|1xt8A1|5e-48|25.5|231/248|c.94.1.1 :=================================== :BL:SWS|41->275|FLIY_ECOLI|4e-47|35.9|234/266 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|62->270|PF00497|5e-38|40.4|208/222|SBP_bac_3