[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49907.1 dred0 ABO49907.1 "extracellular solute-binding protein, family 3"
MKKRGLWFLVLVLTLALVTMGCGGGEKEKQAANQEPAKQTEKNTLDQIKEKGVIVAGLDD
TFAPMGYRDESNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMT
VTEERKKSINFSVPYVGDGQIMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGI
KEVKLYKTYPEAFTDLQIGRIPVVVCDRITASHYISKRADTYEIVGEKITDEPLAIGLRK
SDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK
//