[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49938.1"

            "glycosyl transferase, family 2"
            ""

OrgPattern -------1----------------------------------------------1-1---1------- 11-11-----------------------------------------------------------------------------111223---1-------1-31-2-1-----------------1-----1-11--11111---111222222--11111111113-2322-1-----1---------1-12222231311132111111-1111223-1-2---11111125------------------1-1--------1--1------1-------11------------1-1---------------------------21122221323231-222----3-----21--22-8311-1---11-1111-----------------------------------21111111-2-------------------------------------2------1------------1111-11111111----------11111------1----1111------1-11--111222-11---21--111-----111111111-11--1111---1---2----2112211-111-1-1111-1-11111-1-1---------1--1111111-----1-----1-1--------1-1--2-----------112121------------------------------11111111----------------1-------1-111111111111---1-----11111-1-1111111111111111111111-11------------------------------21111111111-1111111111111111--11113322------------------------------------1-11111111121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGNRISLCMIVKNEEGNIRRCLASVTGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEWN:Sequence :ccccEEEEEEEcccTTTHHHHHHHHGGGcTEEEEEEcccccTHHHHHHTTTcEEEEcccc:Sec Str : ==========================================================:RP:SCP|3->99|1omxA|4e-15|14.4|97/250|c.68.1.15 : =========================================================:BL:SWS|4->270|Y270_SYNE7|1e-29|33.8|263/403 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->106|PF00535|5e-14|46.8|94/148|Glycos_transf_2 61: . . . * . .: 120 :NNFSDARNFSLAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLGKEG:Sequence :ccHHHHHHHHHHHccccEEEEcccccccccTTHHHHHHHHHccccccEEEEEEEccccTH:Sec Str :======================================= :RP:SCP|3->99|1omxA|4e-15|14.4|97/250|c.68.1.15 :============================================================:BL:SWS|4->270|Y270_SYNE7|1e-29|33.8|263/403 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|13->106|PF00535|5e-14|46.8|94/148|Glycos_transf_2 121: . . + . . .: 180 :WTETCPDLVFRLFKNRSQYRFRGAIHEQIADVILEKNKQATYRIAEDIIIIHYGYLDSQI:Sequence :HHHTTccEEEccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccTTTTHHHHcc:Sec Str :============================================================:BL:SWS|4->270|Y270_SYNE7|1e-29|33.8|263/403 181: . * . . . .: 240 :DQKDKKNRNLHIIQKEMVENPGNYLLKYHYGVELYRAERYGEAAEVLIQAANNTDSSTIY:Sequence :ccHHHHTcGGGccccccHHHHHHHHHHHHHccccccGGGTHccccHHHHHHHHHHHTHHH:Sec Str :============================================================:BL:SWS|4->270|Y270_SYNE7|1e-29|33.8|263/403 241: + . . . . *: 300 :FPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHYYGGLSLLQLKHYHKAVELFL:Sequence :cHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHcccHHHHH:Sec Str : ===================================================:RP:SCP|250->627|1w3bA|5e-23|13.6|367/388|a.118.8.1 :============================== :BL:SWS|4->270|Y270_SYNE7|1e-29|33.8|263/403 : ==================================================:BL:SWS|251->616|SEC_ARATH|2e-07|25.6|324/977 301: . . . . + .: 360 :QAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRDNPGFQPALER:Sequence :HHHHHHHHHHccccEEEEHHEEETccccccHHHHHHcHHHHHHHHHHHccHHEEEEcHHH:Sec Str :============================================================:RP:SCP|250->627|1w3bA|5e-23|13.6|367/388|a.118.8.1 :============================================================:BL:SWS|251->616|SEC_ARATH|2e-07|25.6|324/977 361: . . . * . .: 420 :IIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSS:Sequence :HHHHHTTcccHHHHHHTTcEEEEcEcTTHHHHHHTTcHHHcccccccccccccHHHcTTc:Sec Str :============================================================:RP:SCP|250->627|1w3bA|5e-23|13.6|367/388|a.118.8.1 :============================================================:BL:SWS|251->616|SEC_ARATH|2e-07|25.6|324/977 : $$$$$$$$$$:RP:PFM|411->503|PF00755|8e-05|29.2|89/578|Carn_acyltransf 421: . . + . . .: 480 :AEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQE:Sequence :HHHHHHHHHHHHHTTccTTHHHHHHHHHHHcTTcHHHHHHHHHHHHHTTccccHHHHHHH:Sec Str :============================================================:RP:SCP|250->627|1w3bA|5e-23|13.6|367/388|a.118.8.1 :============================================================:BL:SWS|251->616|SEC_ARATH|2e-07|25.6|324/977 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|411->503|PF00755|8e-05|29.2|89/578|Carn_acyltransf 481: . * . . . .: 540 :IRTLEPAEDTESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELF:Sequence :HTcHHHHHHHHHHHHHTHHHHHHHHHcTTcHHHHHHHHHHHTTTcGGGcHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|250->627|1w3bA|5e-23|13.6|367/388|a.118.8.1 :============================================================:BL:SWS|251->616|SEC_ARATH|2e-07|25.6|324/977 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|411->503|PF00755|8e-05|29.2|89/578|Carn_acyltransf : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|501->599|PF07079|1e-04|25.3|99/549|DUF1347 541: + . . . . *: 600 :SRVDPKCLGDRMLDIIRLYHEHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIE:Sequence :HHTccHcHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHTTTGGHHHHHHHHHHTT:Sec Str :============================================================:RP:SCP|250->627|1w3bA|5e-23|13.6|367/388|a.118.8.1 :============================================================:BL:SWS|251->616|SEC_ARATH|2e-07|25.6|324/977 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|501->599|PF07079|1e-04|25.3|99/549|DUF1347 601: . . . . + .: 660 :ADHHYRYAIELDPSQPRYYISQSKLYEDRSEKIKGEVPLE :Sequence :cHHHTTcccHHHHHHTTccTccccccHHHHHHHHTT :Sec Str :=========================== :RP:SCP|250->627|1w3bA|5e-23|13.6|367/388|a.118.8.1 :================ :BL:SWS|251->616|SEC_ARATH|2e-07|25.6|324/977