[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49942.1 dred0 ABO49942.1 "hypothetical protein"
MGDVRIYTEVLNTINKSKVKRIICPNPNFPPKAVGEKSYVLLKNVNLDFTGPEPKVIFDY
YVSLEYQFEFGYDYCIGRGNDFITLPEGFHLCSYPVDPVLTYSAACEEFELVDGVIKAII
RMDLSVVLCQYQTINVKPSI
//