[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO49955.1"

            "protein of unknown function DUF81"
            ""

OrgPattern -----------------------2142---1------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-114--------------2----------------------------------------------------------------11-----1---------------1-----------------------------------------------------------------------------------------1--------------------11--2-222222-----------------1-------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRGLYEALMSASRAHAKWELEMSNNIIRNRKHLLVLALMMLPLVIPAIGHAADLPGFIGG:Sequence : XXXXXXXXXXXXXXX :SEG|33->47|llvlalmmlplvipa 61: . . . * . .: 120 :KSAYGPSHYNPMMFYGSMAVGICAGLITGCIGAGGGFVITPALMSLGVKGILAVGTDQFH:Sequence : XXXXXXXXXXXXXXXX :SEG|81->96|gicaglitgcigaggg : $$$$$$$$:RP:PFM|113->349|PF01925|8e-12|29.2|195/237|TauE 121: . . + . . .: 180 :IFAKAIMGTVIHKKLGNVNVALAIAFLVGSGIGVTAGGTLNRALFNMNPVLSDFIISLVY:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->349|PF01925|8e-12|29.2|195/237|TauE 181: . * . . . .: 240 :VVMLGFLGFYSMYDFIKNKNTSGDAHGGPEGMTKLAQKLQGVNIAPMVKFDEDIVPGGRK:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->349|PF01925|8e-12|29.2|195/237|TauE 241: + . . . . *: 300 :ISGWFVAFCGAVVGFAAAIMGVGGGFLTFPMFVYGLGVSSFTTVGTDILQIIFTAGYSSI:Sequence : XXXXXXXXXXXXXXXX :SEG|243->258|gwfvafcgavvgfaaa : ===========:BL:SWS|290->383|ABCG1_MOUSE|7e-04|35.1|94/666 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|113->349|PF01925|8e-12|29.2|195/237|TauE 301: . . . . + .: 360 :AQYAVYGYIFYTLAMGMLVGSLLGIQIGAATTKVVSGIYIRAFYAIAIMAGFVNRAFALP:Sequence :============================================================:BL:SWS|290->383|ABCG1_MOUSE|7e-04|35.1|94/666 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|113->349|PF01925|8e-12|29.2|195/237|TauE 361: . . . * . .: 420 :EKMAQMGYISIAKENGVLFSNIGAWVFFGLILIFAVWIILSFIRGLPILRAETAEASMAS:Sequence :======================= :BL:SWS|290->383|ABCG1_MOUSE|7e-04|35.1|94/666 421: . . + . . .: 480 :GKGVSH :Sequence