[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49955.1 dred0 ABO49955.1 "protein of unknown function DUF81"
MRGLYEALMSASRAHAKWELEMSNNIIRNRKHLLVLALMMLPLVIPAIGHAADLPGFIGG
KSAYGPSHYNPMMFYGSMAVGICAGLITGCIGAGGGFVITPALMSLGVKGILAVGTDQFH
IFAKAIMGTVIHKKLGNVNVALAIAFLVGSGIGVTAGGTLNRALFNMNPVLSDFIISLVY
VVMLGFLGFYSMYDFIKNKNTSGDAHGGPEGMTKLAQKLQGVNIAPMVKFDEDIVPGGRK
ISGWFVAFCGAVVGFAAAIMGVGGGFLTFPMFVYGLGVSSFTTVGTDILQIIFTAGYSSI
AQYAVYGYIFYTLAMGMLVGSLLGIQIGAATTKVVSGIYIRAFYAIAIMAGFVNRAFALP
EKMAQMGYISIAKENGVLFSNIGAWVFFGLILIFAVWIILSFIRGLPILRAETAEASMAS
GKGVSH
//